Clone Name | rbah62g07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VGLH_EHV1B (Q6DLH1) Glycoprotein H precursor | 28 | 7.7 | 2 | VGLH_EHV1 (P68330) Glycoprotein H precursor | 28 | 7.7 | 3 | ILA2_CAEEL (Q21508) Probable insulin-like peptide alpha-type 2 p... | 28 | 7.7 |
---|
>VGLH_EHV1B (Q6DLH1) Glycoprotein H precursor| Length = 848 Score = 27.7 bits (60), Expect = 7.7 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +3 Query: 69 TVTLHRAIADAAGLTVPRNILLNSIGTLVLSH*LLICFFIITL 197 TVTL A A + VP L SIG L+L+ +LI + II + Sbjct: 791 TVTLMSAFASYSSFKVPSTYLWASIGGLLLA--ILILYIIIKM 831
>VGLH_EHV1 (P68330) Glycoprotein H precursor| Length = 848 Score = 27.7 bits (60), Expect = 7.7 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +3 Query: 69 TVTLHRAIADAAGLTVPRNILLNSIGTLVLSH*LLICFFIITL 197 TVTL A A + VP L SIG L+L+ +LI + II + Sbjct: 791 TVTLMSAFASYSSFKVPSTYLWASIGGLLLA--ILILYIIIKM 831
>ILA2_CAEEL (Q21508) Probable insulin-like peptide alpha-type 2 precursor| Length = 83 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +3 Query: 168 LLICFFIITLEIRSLQAHTN 227 +LICFFI +++ ++ AHT+ Sbjct: 6 ILICFFIFLVQVSTMDAHTD 25 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,576,344 Number of Sequences: 219361 Number of extensions: 666470 Number of successful extensions: 1406 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1406 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)