| Clone Name | rbah62g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HHP2_SCHPO (P40236) Casein kinase I homolog hhp2 (EC 2.7.11.1) | 28 | 4.6 | 2 | ATPF_MESVI (Q9MUT1) ATP synthase B chain (EC 3.6.3.14) (ATPase s... | 28 | 4.6 | 3 | RPTN_MOUSE (P97347) Repetin | 28 | 6.0 | 4 | INADL_HUMAN (Q8NI35) InaD-like protein (Inadl protein) (hINADL) ... | 28 | 6.0 | 5 | TIG_SYMTH (Q67SK1) Trigger factor (TF) | 28 | 6.0 |
|---|
>HHP2_SCHPO (P40236) Casein kinase I homolog hhp2 (EC 2.7.11.1)| Length = 400 Score = 28.5 bits (62), Expect = 4.6 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = -3 Query: 192 ITNSMRMSILTFLVTSLNILQLEDGRKFTAELMKTCILNFSKILSMMRVSYVSS 31 +TNS ++ L SL L GRKFT +KT +L +++S R+ YV S Sbjct: 76 VTNSYNAMVMDLLGPSLEDLFCYCGRKFT---LKTVLLLADQLIS--RIEYVHS 124
>ATPF_MESVI (Q9MUT1) ATP synthase B chain (EC 3.6.3.14) (ATPase subunit I)| Length = 186 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = -3 Query: 168 ILTFLVTSLNILQLEDGRKFTAELMKTCILNFSKILSMMRVS 43 ILT + T L+ + L +G F ++ +T ILN + +L ++ S Sbjct: 4 ILTNIFTILSRMSLAEGFGFNTDIFETNILNLAVVLGILLTS 45
>RPTN_MOUSE (P97347) Repetin| Length = 1130 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 4 GEDVH*NVLRGDIRDSHHGEDFREVQNAGFHEFCSE 111 G+ H + +++ SHHG+ R+ QN+ +H S+ Sbjct: 566 GQSFHFDQAGREVQGSHHGQTDRQSQNSNWHRTDSQ 601
>INADL_HUMAN (Q8NI35) InaD-like protein (Inadl protein) (hINADL)| (Pals1-associated tight junction protein) (Protein associated to tight junctions) Length = 1801 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 241 KQQKFDEPQIQVHESFHHQLNENEHPHVSCD*FEYITAR 125 K++ DEP + + +SFH Q E E + + E++T R Sbjct: 822 KEELVDEPFLDLGKSFHSQQKEIEQSKEAWEMHEFLTPR 860
>TIG_SYMTH (Q67SK1) Trigger factor (TF)| Length = 429 Score = 28.1 bits (61), Expect = 6.0 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -2 Query: 220 PQIQVHESFHHQLNENEHPHVSCD*FEYITARRR*KVHCRTHENLHFEL 74 P++ VH+ H +++ EH + IT ++ +THE+LH EL Sbjct: 304 PEVLVHDKVHDMIHDFEHQLAQ----QGITLDMWHQITGKTHEDLHKEL 348 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,402,266 Number of Sequences: 219361 Number of extensions: 543830 Number of successful extensions: 1506 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1505 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)