Clone Name | rbah62f23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OPT7_ARATH (O82485) Oligopeptide transporter 7 (AtOPT7) | 30 | 6.9 | 2 | YEJ6_SCHPO (O14106) Hypothetical protein C31G5.06 in chromosome I | 29 | 9.0 |
---|
>OPT7_ARATH (O82485) Oligopeptide transporter 7 (AtOPT7)| Length = 766 Score = 29.6 bits (65), Expect = 6.9 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = -3 Query: 383 GVLKLAVGGSSGACLRWWNEEQGSCSY*SCPLRSSAPVESKRGSSLEGCKL 231 GVL G L WW E C SCP +AP G +EGC L Sbjct: 722 GVLLYMCLGLENVSLDWWGNELDGCPLASCP---TAP-----GIIVEGCPL 764
>YEJ6_SCHPO (O14106) Hypothetical protein C31G5.06 in chromosome I| Length = 234 Score = 29.3 bits (64), Expect = 9.0 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 12/87 (13%) Frame = -2 Query: 498 LLRQVLHKRRRSTQEKKCLNLICSELRSENFHLGIYRRGSFEAGSWWKQWRMSSVVE--- 328 LL+++ + STQ +L C++++ L RR + G W QW + + + Sbjct: 112 LLKEISSLKETSTQN----HLHCNDIKILQDCL---RRPNISNGGIWVQWNLEEINQLKK 164 Query: 327 ---------RRTGIMFILVMPPPFLRS 274 R++ I + ++P PFL+S Sbjct: 165 FLSFRKLYPRQSFISLLQILPEPFLKS 191 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,531,118 Number of Sequences: 219361 Number of extensions: 1930262 Number of successful extensions: 4843 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4842 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)