>LAMB3_HUMAN (Q13751) Laminin beta-3 chain precursor (Laminin 5 beta 3) (Laminin|
           B1k chain) (Kalinin B1 chain)
          Length = 1172

 Score = 28.5 bits (62), Expect = 4.5
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = +2

Query: 137 PKETTXAXPRSMIXGRHSFVLCPRNTGGPHETTCDPFF 250
           PK    A P + +   H   +C  NT GP+   C PF+
Sbjct: 261 PKPGASAGPSTAVQV-HDVCVCQHNTAGPNCERCAPFY 297


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,067,101
Number of Sequences: 219361
Number of extensions: 642436
Number of successful extensions: 1003
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 985
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1003
length of database: 80,573,946
effective HSP length: 79
effective length of database: 63,244,427
effective search space used: 1517866248
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)