ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbah62e24 |
|---|---|
| Clone Library Name | barley_pub |
>SYGB_VIBCH (Q9KVW8) Glycyl-tRNA synthetase beta chain (EC 6.1.1.14)| (Glycine--tRNA ligase beta chain) (GlyRS) Length = 688 Score = 35.0 bits (79), Expect = 0.11 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -3 Query: 351 GKAPAGDDPWAEKRRFLGYLSLEVLYSTLLDLINL 247 G+AP G DP+A +R LG L + V Y LDL++L Sbjct: 467 GQAPKGSDPFALRRASLGVLRILVEYGYQLDLVDL 501
>SYGB_VIBVY (Q7MQI8) Glycyl-tRNA synthetase beta chain (EC 6.1.1.14)| (Glycine--tRNA ligase beta chain) (GlyRS) Length = 693 Score = 34.7 bits (78), Expect = 0.14 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -3 Query: 351 GKAPAGDDPWAEKRRFLGYLSLEVLYSTLLDLINL 247 G+AP G DP+A +R LG L + V Y LDL++L Sbjct: 467 GQAPKGSDPFALRRASLGVLRIIVEYGYNLDLVDL 501
>SYGB_VIBVU (Q8DDJ7) Glycyl-tRNA synthetase beta chain (EC 6.1.1.14)| (Glycine--tRNA ligase beta chain) (GlyRS) Length = 693 Score = 34.7 bits (78), Expect = 0.14 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -3 Query: 351 GKAPAGDDPWAEKRRFLGYLSLEVLYSTLLDLINL 247 G+AP G DP+A +R LG L + V Y LDL++L Sbjct: 467 GQAPKGSDPFALRRASLGVLRIIVEYGYNLDLVDL 501
>SYGB_VIBPA (Q87TP8) Glycyl-tRNA synthetase beta chain (EC 6.1.1.14)| (Glycine--tRNA ligase beta chain) (GlyRS) Length = 688 Score = 34.7 bits (78), Expect = 0.14 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -3 Query: 351 GKAPAGDDPWAEKRRFLGYLSLEVLYSTLLDLINL 247 G+AP G DP+A +R LG L + V Y LDL++L Sbjct: 467 GQAPKGSDPFALRRASLGVLRIIVEYGYNLDLVDL 501
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 30.4 bits (67), Expect = 2.7 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -1 Query: 200 DCVLCDGVSAGCLCCPWVPCLVY*CWACSYKLGSQLNLIHGIVSCLRSLEAPLHRDESCC 21 DC C G GC C C Y CS GS C S P SCC Sbjct: 69 DCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSS--------CCQSSCCKPCCSQSSCC 120 Query: 20 *P 15 P Sbjct: 121 KP 122
>UVRC_TREPA (O83485) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 691 Score = 30.0 bits (66), Expect = 3.5 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 95 AGCRACNYTPSISTPSKAPKGSKDSQRLHHRTTHNPAHFCHH 220 +G R+C+ T ++ T KA S+ T H AH HH Sbjct: 372 SGLRSCSETSTMHTLQKAHDACTASEGTRENTPHESAHTPHH 413
>ZN469_HUMAN (Q96JG9) Zinc finger protein 469 (Fragment)| Length = 2469 Score = 30.0 bits (66), Expect = 3.5 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 7/83 (8%) Frame = +2 Query: 32 RPGAVVLPEN--GGRRQCRVSSSAGCRACNYTPSISTPSKAPKGSKDSQRLH-----HRT 190 +P A P N G S++A A + P +TPS +P + L H Sbjct: 1788 KPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATPVHEA 1847 Query: 191 THNPAHFCHHLSGRAPVPQRLMR 259 +P+ CHH R P P +L R Sbjct: 1848 CKDPSRDCHHCGKRFPKPFKLQR 1870
>PPSA_PYRAB (Q9V2H7) Probable phosphoenolpyruvate synthase (EC 2.7.9.2)| (Pyruvate, water dikinase) (PEP synthase) Length = 819 Score = 29.6 bits (65), Expect = 4.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 387 WYLTVDHPAEEDGKAPAGDDPWAEKRRFLGY 295 WY T+D P E + P G+D E+ LG+ Sbjct: 585 WYRTLDAPTNEFREMPGGEDEPEERNPMLGW 615
>ARI1B_HUMAN (Q8NFD5) AT-rich interactive domain-containing protein 1B (ARID| domain-containing protein 1B) (Osa homolog 2) (hOsa2) (p250R) (BRG1-binding protein hELD/OSA1) (BRG1-associated factor 250b) (BAF250B) Length = 2236 Score = 29.6 bits (65), Expect = 4.6 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +2 Query: 128 ISTPSKAPKGSKDSQRLHHRTTHNPAHFCHHLSGRAPVPQRL 253 + T +AP Q HH H+ H HHL + Q+L Sbjct: 69 LKTVGEAPAAPPHQQHHHHHHAHHHHHHAHHLHHHHALQQQL 110
>PPSA_PYRFU (P42850) Probable phosphoenolpyruvate synthase (EC 2.7.9.2)| (Pyruvate, water dikinase) (PEP synthase) Length = 817 Score = 29.6 bits (65), Expect = 4.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 387 WYLTVDHPAEEDGKAPAGDDPWAEKRRFLGY 295 WY T+D P E + P G+D E+ LG+ Sbjct: 585 WYRTLDAPTNEFREMPGGEDEPEERNPMLGW 615
>PPSA_PYRHO (O57830) Probable phosphoenolpyruvate synthase (EC 2.7.9.2)| (Pyruvate, water dikinase) (PEP synthase) Length = 821 Score = 29.6 bits (65), Expect = 4.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 387 WYLTVDHPAEEDGKAPAGDDPWAEKRRFLGY 295 WY T+D P E + P G+D E+ LG+ Sbjct: 588 WYRTLDAPTNEFREMPGGEDEPEERNPMLGW 618
>SSPO_BOVIN (P98167) SCO-spondin (Fragment)| Length = 867 Score = 29.6 bits (65), Expect = 4.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 374 TVRYHEMHPYSSSGSTCATRPSVSP 448 T R+ E HP + G TCAT P P Sbjct: 49 TARHRECHPPQNGGRTCATLPGGPP 73
>HAIR_RAT (P97609) Protein hairless| Length = 1181 Score = 29.6 bits (65), Expect = 4.6 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 7/73 (9%) Frame = +2 Query: 98 GCRACNYTPSISTPSKAPKGSKDSQ------RLHHRTTHNPAHFC-HHLSGRAPVPQRLM 256 G RA TP ST SKA ++ Q R+ R + C HHL+G P + Sbjct: 440 GARAWQETPETSTGSKAEAQQQEEQRGPRDGRIRLRESRLEDTSCQHHLAGVTQCPSCVQ 499 Query: 257 RSSRVE*STSRDR 295 + VE TS + Sbjct: 500 AAGEVEILTSHSQ 512
>FOXGB_CHICK (Q90964) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) (CBF-1) (Proto-oncogene C-QIN) (N-62-5) (CEQ 3-1) Length = 451 Score = 28.9 bits (63), Expect = 7.8 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +2 Query: 125 SISTPSKAPKG-SKDSQRLH-HRTTHNPAHFCHHLSGRAPVPQRLMRSSRVE 274 S S S P+ D+ H H +H+P H HH P PQ+ R++ E Sbjct: 17 SFSINSLVPEAVQSDNHSGHSHHNSHHPHHHHHHHHHHPPPPQQPQRAAAAE 68
>EUTK_ECOLI (P76540) Ethanolamine utilization protein eutK precursor| Length = 166 Score = 28.9 bits (63), Expect = 7.8 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +2 Query: 11 LLANNSFRPGAVVLPENGGRRQCRVSSSAGCRACNYTPSISTPSKAPKGSKDSQRL 178 LL++ PG + L G CR + AGC A T + + + + D+Q L Sbjct: 31 LLSHEVLDPGRLTLVVEGDLAACRAALDAGCAAAMRTGRVISRKEIGRPDDDTQWL 86
>CAC1G_RAT (O54898) Voltage-dependent T-type calcium channel alpha-1G subunit| (Voltage-gated calcium channel alpha subunit Cav3.1) Length = 2254 Score = 28.9 bits (63), Expect = 7.8 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +2 Query: 44 VVLPENGGRRQCRVSSSAGCRACNYTPSISTPSKAPKGSKDSQRLHHR-TTHNPAHFCHH 220 V + RR +VS + G RA + ++ + P+ S R H R + H+ H HH Sbjct: 441 VYILRKAARRLAQVSRAIGVRAGLLSSPVARSGQEPQPSGSCTRSHRRLSVHHLVHHHHH 500
>STHY_ARATH (Q9SYM2) Putative salt tolerance-like protein At1g78600| Length = 299 Score = 28.9 bits (63), Expect = 7.8 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 203 LDCVLCDGVSAGCLCCPWVPCLVY*CWACSYKL 105 + C +C+ A LCC L CWAC K+ Sbjct: 3 IQCNVCEAAEATVLCCADEAAL---CWACDEKI 32
>QIN_AVIS3 (P56260) Transforming protein Qin (Oncogene Qin)| Length = 387 Score = 28.9 bits (63), Expect = 7.8 Identities = 18/71 (25%), Positives = 30/71 (42%) Frame = +2 Query: 62 GGRRQCRVSSSAGCRACNYTPSISTPSKAPKGSKDSQRLHHRTTHNPAHFCHHLSGRAPV 241 G R++ ++ + N P +A + S HH + H+P H HH P Sbjct: 5 GDRKEVKMLPKSSFSINNLVP------EAVQSDNHSGHSHHNS-HHPHHHHHHHHHHPPP 57 Query: 242 PQRLMRSSRVE 274 PQ+ R++ E Sbjct: 58 PQQPQRAAAAE 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,270,590 Number of Sequences: 219361 Number of extensions: 1308533 Number of successful extensions: 5029 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 4785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5021 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
