Clone Name | rbah61p17 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZAN_RABIT (P57999) Zonadhesin (Fragment) | 31 | 3.2 | 2 | ENGC_SHEON (Q8EJ79) Probable GTPase engC (EC 3.6.1.-) | 30 | 5.5 |
---|
>ZAN_RABIT (P57999) Zonadhesin (Fragment)| Length = 2282 Score = 31.2 bits (69), Expect = 3.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 224 PSCHRQELRCAASRAPSCCSDDNTC 298 PSC + RC +RAPS C++ TC Sbjct: 1685 PSCFDPDGRCEGARAPSSCAEGCTC 1709
>ENGC_SHEON (Q8EJ79) Probable GTPase engC (EC 3.6.1.-)| Length = 354 Score = 30.4 bits (67), Expect = 5.5 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 5/68 (7%) Frame = -1 Query: 554 GPELQGENVDTLFTSPEVLHTWASAIIDAYYSSREGT-----LLGQARDLMNPKIIKRVE 390 G ++ N+D + VL ++ + IID Y + E T ++ DL+ P+ +E Sbjct: 119 GVKIIASNIDQILIVSSVLPSFTTQIIDRYLVAAEDTDIPPIIILNKIDLLTPEEAPAIE 178 Query: 389 ELVKTIKD 366 E +K +D Sbjct: 179 EALKRYQD 186 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,511,817 Number of Sequences: 219361 Number of extensions: 1937469 Number of successful extensions: 5446 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5443 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)