Clone Name | rbah61p16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DCBD2_HUMAN (Q96PD2) Discoidin, CUB and LCCL domain-containing p... | 30 | 6.7 |
---|
>DCBD2_HUMAN (Q96PD2) Discoidin, CUB and LCCL domain-containing protein 2| precursor (Endothelial and smooth muscle cell-derived neuropilin-like protein) (CUB, LCCL and coagulation factor V/VIII-homology domains protein 1) Length = 775 Score = 29.6 bits (65), Expect = 6.7 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -1 Query: 558 APPMALMPCSFFLSPCHLAPSPAFPLILYLLLV 460 AP A +P S L PC + S + PL L LLLV Sbjct: 24 APAWAALPLSRSLPPCSNSSSFSMPLFLLLLLV 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,799,167 Number of Sequences: 219361 Number of extensions: 1072505 Number of successful extensions: 2446 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2444 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)