>DCBD2_HUMAN (Q96PD2) Discoidin, CUB and LCCL domain-containing protein 2|
           precursor (Endothelial and smooth muscle cell-derived
           neuropilin-like protein) (CUB, LCCL and coagulation
           factor V/VIII-homology domains protein 1)
          Length = 775

 Score = 29.6 bits (65), Expect = 6.7
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = -1

Query: 558 APPMALMPCSFFLSPCHLAPSPAFPLILYLLLV 460
           AP  A +P S  L PC  + S + PL L LLLV
Sbjct: 24  APAWAALPLSRSLPPCSNSSSFSMPLFLLLLLV 56


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 65,799,167
Number of Sequences: 219361
Number of extensions: 1072505
Number of successful extensions: 2446
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2385
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2444
length of database: 80,573,946
effective HSP length: 106
effective length of database: 57,321,680
effective search space used: 5101629520
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)