| Clone Name | rbah62e21 |
|---|---|
| Clone Library Name | barley_pub |
>RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase activase A,| chloroplast precursor (RuBisCO activase A) (RA A) Length = 464 Score = 86.3 bits (212), Expect = 2e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -2 Query: 238 GKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 125 GKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF Sbjct: 427 GKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 464
>RCA_ARATH (P10896) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 474 Score = 67.8 bits (164), Expect = 7e-12 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 238 GKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 125 GKGAQQ LPVPEGCTD A+N+DPTARSDDG+C+Y F Sbjct: 437 GKGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF 474
>RCA1_LARTR (Q7X9A0) Ribulose bisphosphate carboxylase/oxygenase activase 1,| chloroplast precursor (RuBisCO activase 1) (RA 1) (RubisCO activase alpha form) Length = 476 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/40 (75%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 241 GGKGAQQ-GTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 125 GG+ AQQ G +PVPEGCTD A NYDPTARSDDGSC+Y F Sbjct: 437 GGQAAQQVGNVPVPEGCTDPQATNYDPTARSDDGSCVYKF 476
>RCA_SPIOL (P10871) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 472 Score = 63.9 bits (154), Expect = 1e-10 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 238 GKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLY 131 GK AQQ +LPV +GCTD AKNYDPTARSDDGSC Y Sbjct: 435 GKAAQQVSLPVAQGCTDPEAKNYDPTARSDDGSCTY 470
>LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor| Length = 3695 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 142 CRRRSLPLGRSSWHFGRCNLP 204 CRR P GR H GRCN P Sbjct: 2114 CRRCQCPGGRCDPHTGRCNCP 2134
>CCMF_ARATH (P93286) Putative cytochrome c biogenesis ccmF-like mitochondrial| protein Length = 442 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 212 ARAGRLHRPKCQELRPNGKERRR 144 A+ R R K Q LRPNG E+RR Sbjct: 147 AKRERARRRKGQTLRPNGNEQRR 169
>YKB4_YEAST (P34241) Hypothetical 203.3 kDa protein in PUT3-ARC19 intergenic| region Length = 1764 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 208 VPEGCTDQNAKNYDPTARSD 149 VPE TD N NYD T R D Sbjct: 1383 VPELYTDSNTNNYDATTRCD 1402
>TFE2_XENLA (Q01978) Transcription factor E2-alpha (Transcription factor| XE12/XE47) Length = 658 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -2 Query: 268 TPTISCCIGGGKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGS 140 T S GGG G ++ T P G D N +D DG+ Sbjct: 38 TTLASTQFGGGSGLEERTGSAPWGTEDHNGSTFDQGRGYGDGT 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,715,422 Number of Sequences: 219361 Number of extensions: 745700 Number of successful extensions: 2044 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2044 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)