| Clone Name | rbah61p14 |
|---|---|
| Clone Library Name | barley_pub |
>APGM_METKA (P58813) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 422 Score = 52.8 bits (125), Expect = 5e-07 Identities = 34/107 (31%), Positives = 45/107 (42%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAICRLRDFVGAIGEDNVMNTPLDDFPLPSVKSGEDLT 258 +C+T DHSTPV GDH+ +PVP AI Sbjct: 351 VCLTADHSTPVAVGDHTADPVPVAIW---------------------------------- 376 Query: 257 DDSEPAERKPEERKAFSGDKVCEYTEIAAARGCLGRFPGSEMMGIIK 117 + A R P E EY EI+AARGCLGRF G ++ +++ Sbjct: 377 --TADARRDPVE----------EYDEISAARGCLGRFSGLHLLNVLR 411
>APGM_THEAC (Q9HL27) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 404 Score = 39.7 bits (91), Expect = 0.004 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVP 372 +CVTGDHSTP + DHS +PVP Sbjct: 334 ICVTGDHSTPCSFKDHSGDPVP 355
>APGM_PICTO (Q6KZJ6) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 402 Score = 39.7 bits (91), Expect = 0.004 Identities = 28/67 (41%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVP--FAICRLR-DFVGAIGEDNVMNTPLDDFPLPSVKSGE 267 + VTGDHSTP GDHS +PVP F+ +R D V E +V N L L +K Sbjct: 332 IIVTGDHSTPCNLGDHSGDPVPIMFSSNNIRSDNVMLFDETSVRNGSLRIRGLDVMKIAL 391 Query: 266 DLTDDSE 246 L++ SE Sbjct: 392 SLSNRSE 398
>APGM1_METJA (Q59007) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase 1 (EC 5.4.2.1) (Phosphoglyceromutase 1) (BPG-independent PGAM 1) (aPGAM 1) (aPGAM-Mj1) Length = 411 Score = 38.9 bits (89), Expect = 0.008 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -2 Query: 446 QYFLCVTGDHSTPVEYGDHSFEPVPFAI 363 + + +TGDHSTP+E DHS +P+P I Sbjct: 337 EVYFVLTGDHSTPIEMKDHSADPIPIVI 364
>APGM_SULAC (Q4JAH5) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 413 Score = 37.7 bits (86), Expect = 0.017 Identities = 21/59 (35%), Positives = 32/59 (54%) Frame = -2 Query: 446 QYFLCVTGDHSTPVEYGDHSFEPVPFAICRLRDFVGAIGEDNVMNTPLDDFPLPSVKSG 270 + + +TGDH+TPVE +H+ +PVPF + + V DNV DDF ++ G Sbjct: 339 ELIIAITGDHATPVEVKEHTGDPVPFLLYVPYNIVA----DNV-----DDFNEKQLRKG 388
>APGM_SULTO (Q975P3) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 413 Score = 36.6 bits (83), Expect = 0.037 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAICRLRDFVGAIGED 324 + ++GDH+TPVE +H+ +PVPF + D + + D Sbjct: 342 IAISGDHTTPVEVKEHTGDPVPFLLYVPYDIINDVVND 379
>APGM1_METTH (O27628) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase 1 (EC 5.4.2.1) (Phosphoglyceromutase 1) (BPG-independent PGAM 1) (aPGAM 1) Length = 409 Score = 36.2 bits (82), Expect = 0.049 Identities = 34/115 (29%), Positives = 43/115 (37%) Frame = -2 Query: 443 YFLCVTGDHSTPVEYGDHSFEPVPFAICRLRDFVGAIGEDNVMNTPLDDFPLPSVKSGED 264 YF+ +T DHSTPV DH+ +PVP AI Sbjct: 337 YFI-LTADHSTPVSVMDHTGDPVPIAI--------------------------------- 362 Query: 263 LTDDSEPAERKPEERKAFSGDKVCEYTEIAAARGCLGRFPGSEMMGIIKKFMKAK 99 PE R D V ++E AAA G L R GS++M I+ M K Sbjct: 363 ---------TGPEVRV----DDVTSFSERAAAAGGLCRIRGSDVMDILLDLMNKK 404
>APGM_METMA (Q8PX04) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 397 Score = 35.4 bits (80), Expect = 0.084 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 4/63 (6%) Frame = -2 Query: 488 LARLLWEAEKSGHYQYFLCVTGDHSTPVEYGDHSFEPVPFAICRL----RDFVGAIGEDN 321 +A +L AE S + + V DH TP+ H+ +P+PFAI R D V A E++ Sbjct: 318 VAPILEYAENSDE-PFTILVLPDHPTPISVKTHTRDPIPFAIYRTDKPETDNVEAFDEES 376 Query: 320 VMN 312 V N Sbjct: 377 VKN 379
>APGM_PYRFU (P58814) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 411 Score = 35.4 bits (80), Expect = 0.084 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAICR---LRDFVGAIGEDNVM 315 + +TGDHSTP E +HS +PVP I D+ GE M Sbjct: 340 IAITGDHSTPCEVMNHSGDPVPLLIAGGGVRADYTEKFGEREAM 383
>APGM_PYRAB (Q9V2M6) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 410 Score = 35.4 bits (80), Expect = 0.084 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAI 363 + +TGDHSTP E +HS +PVP I Sbjct: 339 IAITGDHSTPCEVKNHSGDPVPLLI 363
>APGM_PYRHO (O57742) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 412 Score = 35.0 bits (79), Expect = 0.11 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAI 363 + +TGDHSTP E +HS +PVP I Sbjct: 341 IAITGDHSTPCEVMNHSGDPVPLLI 365
>APGM_PYRKO (Q5JI21) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 411 Score = 35.0 bits (79), Expect = 0.11 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAI 363 + +TGDHSTP E +HS +PVP I Sbjct: 340 IAITGDHSTPCEVMNHSGDPVPLLI 364
>APGM_THEMA (Q9X295) Probable 2,3-bisphosphoglycerate-independent| phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 401 Score = 35.0 bits (79), Expect = 0.11 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAI 363 L +TGDHSTPV HS+ PVP I Sbjct: 330 LVITGDHSTPVPLKAHSWHPVPLLI 354
>APGM_METMP (Q6LXB3) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 406 Score = 34.7 bits (78), Expect = 0.14 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -2 Query: 446 QYFLCVTGDHSTPVEYGDHSFEPVPFAI 363 + + ++GDHSTP+E DHS +P+P + Sbjct: 332 EVYFVLSGDHSTPIEEMDHSADPLPVVL 359
>APGM1_ARCFU (O28523) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase 1 (EC 5.4.2.1) (Phosphoglyceromutase 1) (BPG-independent PGAM 1) (aPGAM 1) Length = 408 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAICR---LRDFVGAIGE 327 L +T DHSTP++ DH+ +PVP I RD V + E Sbjct: 337 LILTADHSTPIKVKDHTADPVPVVIVHEDVRRDEVSSFSE 376
>APGM_THEVO (Q979H8) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 406 Score = 33.9 bits (76), Expect = 0.24 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVP 372 + +TGDHSTP DHS +PVP Sbjct: 336 VAITGDHSTPCSVKDHSGDPVP 357
>APGM_PYRAE (Q8ZVE4) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 411 Score = 33.1 bits (74), Expect = 0.41 Identities = 26/111 (23%), Positives = 40/111 (36%) Frame = -2 Query: 440 FLCVTGDHSTPVEYGDHSFEPVPFAICRLRDFVGAIGEDNVMNTPLDDFPLPSVKSGEDL 261 + VT DH+TPV +H+ EPVP + G D V Sbjct: 339 YFVVTSDHATPVSVKEHTGEPVPILL---------YGPDVVQ------------------ 371 Query: 260 TDDSEPAERKPEERKAFSGDKVCEYTEIAAARGCLGRFPGSEMMGIIKKFM 108 D V +++E+ RG LGR G ++M I+ ++ Sbjct: 372 -------------------DDVSKFSELTCWRGALGRIRGIDVMPILGSYL 403
>APGM_AERPE (Q9YBI2) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 424 Score = 33.1 bits (74), Expect = 0.41 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -2 Query: 431 VTGDHSTPVEYGDHSFEPVPFAICRLRDFVGAIGE 327 VT DH+TP + G HS +PVP I + G+IG+ Sbjct: 361 VTSDHATPWDVGAHSGDPVPLMISH-QSIQGSIGK 394
>APGM_AQUAE (O66820) Probable 2,3-bisphosphoglycerate-independent| phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 407 Score = 32.7 bits (73), Expect = 0.54 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAI 363 L +TGDHSTP HS+ PVP I Sbjct: 336 LAITGDHSTPSILKGHSWHPVPLLI 360
>APGM_SULSO (Q980A0) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 414 Score = 32.7 bits (73), Expect = 0.54 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 455 GHYQYFLCVTGDHSTPVEYGDHSFEPVP 372 G L TGDH TPVE +H+ +PVP Sbjct: 337 GRDNLILMFTGDHVTPVEIKEHTGDPVP 364
>APGM_THET8 (Q5SM27) Probable 2,3-bisphosphoglycerate-independent| phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 406 Score = 32.3 bits (72), Expect = 0.71 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAI 363 L +TGDHSTP HS+ PVP + Sbjct: 335 LAITGDHSTPALLKAHSWHPVPLLL 359
>APGM_THET2 (Q72GG0) Probable 2,3-bisphosphoglycerate-independent| phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 406 Score = 32.3 bits (72), Expect = 0.71 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAI 363 L +TGDHSTP HS+ PVP + Sbjct: 335 LAITGDHSTPALLKAHSWHPVPLLL 359
>APGM_DEIRA (Q9RSA0) Probable 2,3-bisphosphoglycerate-independent| phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 410 Score = 32.3 bits (72), Expect = 0.71 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 437 LCVTGDHSTPVEYGDHSFEPVPFAI 363 + V GDHSTP + HS+ PVP I Sbjct: 339 IAVVGDHSTPSKLKSHSWHPVPLLI 363
>APGM_METAC (P58812) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 397 Score = 32.0 bits (71), Expect = 0.92 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Frame = -2 Query: 479 LLWEAEKSGHYQYFLCVTGDHSTPVEYGDHSFEPVPFAICRL----RDFVGAIGEDNVMN 312 +L AE S + + V DH TP+ H+ +P+PFAI R D V E++V N Sbjct: 321 ILKHAEASDE-TFTILVLPDHPTPISVKTHTRDPIPFAIYRTDAADPDGVEYFDEESVKN 379
>PBP2_ECOLI (P0AD65) Penicillin-binding protein 2 (PBP-2)| Length = 633 Score = 31.2 bits (69), Expect = 1.6 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = -2 Query: 326 DNVMNTPLDDFPLPSVKSGEDLTDDSEPAERKPEERK-AFSGDKV-CEYTEIAAARGCLG 153 DNV T L +++S DLTDD A RK R F+ V TE+ AR + Sbjct: 96 DNVQQT------LDALRSVVDLTDDDIAAFRKERARSHRFTSIPVKTNLTEVQVARFAVN 149 Query: 152 --RFPGSEMMGIIKKF 111 RFPG E+ G +++ Sbjct: 150 QYRFPGVEVKGYKRRY 165
>PBP2_ECOL6 (P0AD66) Penicillin-binding protein 2 (PBP-2)| Length = 633 Score = 31.2 bits (69), Expect = 1.6 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = -2 Query: 326 DNVMNTPLDDFPLPSVKSGEDLTDDSEPAERKPEERK-AFSGDKV-CEYTEIAAARGCLG 153 DNV T L +++S DLTDD A RK R F+ V TE+ AR + Sbjct: 96 DNVQQT------LDALRSVVDLTDDDIAAFRKERARSHRFTSIPVKTNLTEVQVARFAVN 149 Query: 152 --RFPGSEMMGIIKKF 111 RFPG E+ G +++ Sbjct: 150 QYRFPGVEVKGYKRRY 165
>PBP2_ECO57 (P0AD67) Penicillin-binding protein 2 (PBP-2)| Length = 633 Score = 31.2 bits (69), Expect = 1.6 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = -2 Query: 326 DNVMNTPLDDFPLPSVKSGEDLTDDSEPAERKPEERK-AFSGDKV-CEYTEIAAARGCLG 153 DNV T L +++S DLTDD A RK R F+ V TE+ AR + Sbjct: 96 DNVQQT------LDALRSVVDLTDDDIAAFRKERARSHRFTSIPVKTNLTEVQVARFAVN 149 Query: 152 --RFPGSEMMGIIKKF 111 RFPG E+ G +++ Sbjct: 150 QYRFPGVEVKGYKRRY 165
>APGM_GEOSL (Q74C57) Probable 2,3-bisphosphoglycerate-independent| phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (aPGAM) Length = 399 Score = 30.0 bits (66), Expect = 3.5 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -2 Query: 464 EKSGHYQYFLCVTGDHSTPVEYGDHSFEPVPFAI 363 EK G Y+ LC T DH TP+ H+ PVPF + Sbjct: 329 EKFGSYR-ILC-TPDHPTPLRLKTHTDAPVPFVL 360
>SCRB1_MOUSE (Q61009) Scavenger receptor class B member 1 (SRB1) (SR-BI)| Length = 509 Score = 25.4 bits (54), Expect(2) = 4.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 174 SNLGVFTHFIATKSFTLLRLAFRW 245 SN GVFT F ++F+ + L +W Sbjct: 214 SNSGVFTVFTGVQNFSRIHLVDKW 237 Score = 22.7 bits (47), Expect(2) = 4.6 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +1 Query: 361 HIANGTGSKLWSPYST 408 ++ NGT ++W+P+ T Sbjct: 252 NMINGTSGQMWAPFMT 267
>NUHM_SCHPO (O13691) Probable NADH-ubiquinone oxidoreductase 24 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) Length = 162 Score = 29.3 bits (64), Expect = 6.0 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -1 Query: 426 WRPLYSC*VRRPQLRTCP--VCDMPAERFRGSNWGGQC 319 WRP ++P++R C +C AE SNW QC Sbjct: 78 WRP------KKPRVRICNSWMCQQAAEEQGNSNWDSQC 109
>HDAC1_STRPU (P56518) Histone deacetylase 1 (HD1)| Length = 576 Score = 29.3 bits (64), Expect = 6.0 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 7/53 (13%) Frame = -2 Query: 308 PLDDFPLPSVKSGEDLTDDS-------EPAERKPEERKAFSGDKVCEYTEIAA 171 P+D P P K ED + S +PAE++P E +A D V +++A Sbjct: 481 PMDTTPAPPPKKSEDKPEASKPTEVKAKPAEKEPGEGEASPADLVVPVPKVSA 533
>ADA15_HUMAN (Q13444) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) Length = 814 Score = 29.3 bits (64), Expect = 6.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 311 TPLDDFPLPSVKSGEDLTDDSEPAERKPEERKAFSGD 201 +PL +PLP++ E+ +SE A R+P E + D Sbjct: 16 SPLPSWPLPNIGGTEEQQAESEKAPREPLEPQVLQDD 52
>UPP1_HUMAN (Q16831) Uridine phosphorylase 1 (EC 2.4.2.3) (UrdPase 1) (UPase 1)| Length = 310 Score = 29.3 bits (64), Expect = 6.0 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 443 YFLCVTGDHSTPVEYGDHSFEPVPFAICRLRDFVGAIGEDNVMNTPLDDFP 291 +F T H+ P +GD F V + R++ F+ +G + ++ P D+P Sbjct: 36 HFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYP 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,780,679 Number of Sequences: 219361 Number of extensions: 1526109 Number of successful extensions: 4417 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 4252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4412 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)