Clone Name | rbah61o16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRXB_STRCO (P52215) Thioredoxin reductase (EC 1.8.1.9) (TRXR) | 30 | 3.1 | 2 | SYI_PROMT (Q46HD5) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 29 | 5.2 | 3 | IF1A_YEAST (P38912) Eukaryotic translation initiation factor 1A ... | 28 | 8.9 |
---|
>TRXB_STRCO (P52215) Thioredoxin reductase (EC 1.8.1.9) (TRXR)| Length = 321 Score = 30.0 bits (66), Expect = 3.1 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -2 Query: 450 RAPGIKQYKSFREPEIVCFWDQKLLEKSVNLSHFGLKLTHMKSPYLS 310 RA Q ++F +P+I WD ++ E + GLKL ++K+ LS Sbjct: 181 RASKAMQERAFADPKISFVWDSEVAEVQGDQKLAGLKLRNVKTGELS 227
>SYI_PROMT (Q46HD5) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 967 Score = 29.3 bits (64), Expect = 5.2 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -2 Query: 441 GIKQYKSFREPEIVCFWDQKLLEKSVNLSHFGLKLT-HMKSPY 316 G++ + REPE+ FW +K ++ + L++ G T H PY Sbjct: 27 GMRANATLREPELQAFWREKNIDFELGLNNSGETFTLHDGPPY 69
>IF1A_YEAST (P38912) Eukaryotic translation initiation factor 1A (EIF-1A)| (EIF-4C) Length = 153 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 83 KNVFHTSVVLKTLLYMGRRE*LISPMTLQESDQCSVVQKYN 205 K + H L+ ++MG+ + ++ + + DQC VV KYN Sbjct: 56 KRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYN 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,309,300 Number of Sequences: 219361 Number of extensions: 1282089 Number of successful extensions: 2178 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2178 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)