| Clone Name | rbah61o05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RAD17_MOUSE (Q6NXW6) Cell cycle checkpoint protein RAD17 | 30 | 2.0 | 2 | TGB1_NMV (P15096) TGB1 helicase (EC 3.6.1.-) (Triple gene block ... | 28 | 7.8 | 3 | SYF1_CRYNE (Q5KH46) Pre-mRNA-splicing factor SYF1 | 28 | 7.8 | 4 | P53_CRIGR (O09185) Cellular tumor antigen p53 (Tumor suppressor ... | 28 | 7.8 |
|---|
>RAD17_MOUSE (Q6NXW6) Cell cycle checkpoint protein RAD17| Length = 688 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -3 Query: 262 GTSATPCHQPLYSILQ*KNSRHCITAKKRNCNFC 161 G+S P H+P + ++Q K +C+ AK +FC Sbjct: 516 GSSFRPLHKPQWFLIQKKYRENCLAAKALFVDFC 549
>TGB1_NMV (P15096) TGB1 helicase (EC 3.6.1.-) (Triple gene block 1 protein)| (TGBp1) (25 kDa protein) (ORF 2 protein) Length = 233 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 273 QHEWGLQPPLVTSHCTAFFSKKTADTAS 190 QH WGL P+V+ + T+ S T D A+ Sbjct: 181 QHLWGLTIPVVSVYITSIASLSTVDRAN 208
>SYF1_CRYNE (Q5KH46) Pre-mRNA-splicing factor SYF1| Length = 1031 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 52 LKLPTPIVHPQFFPSNCDVXTLSEAIQNP 138 L +PTPI HP PS D+ + + NP Sbjct: 18 LPIPTPITHPHLIPS-ADLPVEEDLLHNP 45
>P53_CRIGR (O09185) Cellular tumor antigen p53 (Tumor suppressor p53)| Length = 393 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +2 Query: 113 LCQKLFKTLFWHILMSTKITIPFLGGDAVSAVFLLKNAVQWLVTRGG 253 L Q+ F L W +L + D++ +FL +N WL GG Sbjct: 14 LSQETFSDL-WKLLPPNNVLSTLPSSDSIEELFLSENVTGWLEDSGG 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,507,898 Number of Sequences: 219361 Number of extensions: 737978 Number of successful extensions: 1841 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1841 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)