| Clone Name | rbah61o03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RSSB_SERMA (Q8GP20) Swarming motility regulation protein rssB | 32 | 1.9 | 2 | PLIGB_ELAQU (Q9PWI3) Phospholipase A2 inhibitor gamma subunit B ... | 30 | 5.4 | 3 | MT_EISFO (P81695) Cadmium-metallothionein (MT) (Fragment) | 29 | 9.3 |
|---|
>RSSB_SERMA (Q8GP20) Swarming motility regulation protein rssB| Length = 219 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = +1 Query: 94 LSELLAFPILTSTIVAANHLPRLFASLTDQLRSLY*LKLNHHCNKSNTLLYYARSEPYII 273 L++ A P L S + A N FAS T L +LY +NH N LL ++ E +++ Sbjct: 99 LAKPFALPELISRVKAVNRRMAGFASQTWSLGALYLDPVNHQVMLDNELLMLSKKEYHLL 158 Query: 274 N 276 + Sbjct: 159 H 159
>PLIGB_ELAQU (Q9PWI3) Phospholipase A2 inhibitor gamma subunit B precursor| (PLI-gamma B) Length = 200 Score = 30.0 bits (66), Expect = 5.4 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +2 Query: 353 RKCCTCDNCK-MPPPVLPGAHKMPSGDQ 433 R CCT D C+ +PPPVL P+G Q Sbjct: 92 RACCTGDECQTLPPPVLEPQVNRPNGLQ 119
>MT_EISFO (P81695) Cadmium-metallothionein (MT) (Fragment)| Length = 75 Score = 29.3 bits (64), Expect = 9.3 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +2 Query: 362 CTCDNCK-MPPPVLPGAHKMPSGDQGVRKC*RGPFKIRASTRCTVAEMA 505 C C NC+ + LPG K+ D KC K A+ +C+ A Sbjct: 17 CCCTNCRCLKSECLPGCKKLCCADAEKGKCGNAGCKCGAACKCSAGSCA 65 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,551,159 Number of Sequences: 219361 Number of extensions: 1749502 Number of successful extensions: 3809 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3809 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)