| Clone Name | rbah61n21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GCP6_HUMAN (Q96RT7) Gamma-tubulin complex component 6 (GCP-6) | 38 | 0.017 | 2 | UREE_STRT2 (Q5M606) Urease accessory protein ureE | 31 | 1.6 | 3 | UREE_STRT1 (Q5M1G5) Urease accessory protein ureE | 31 | 1.6 | 4 | UREE_STRSL (Q55055) Urease accessory protein ureE | 31 | 1.6 | 5 | UREE_STRVE (Q3S3T7) Urease accessory protein ureE | 30 | 2.7 | 6 | SVF1_EMENI (Q5BH63) Survival factor 1 | 30 | 4.5 |
|---|
>GCP6_HUMAN (Q96RT7) Gamma-tubulin complex component 6 (GCP-6)| Length = 1819 Score = 37.7 bits (86), Expect = 0.017 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = -3 Query: 401 PEGPRASVRARCEMELDRIEKQFDECVVFLLRILSFKLNVGHFPHLADLVTRINYNHYY 225 P GPR + + + + F FL ++++ +N G+ PHL D + RIN+N+YY Sbjct: 1759 PGGPRGAEHPNFAL-MQQSYNTFKYYSHFLFKVVTKLVNRGYQPHLEDFLLRINFNNYY 1816
>UREE_STRT2 (Q5M606) Urease accessory protein ureE| Length = 150 Score = 31.2 bits (69), Expect = 1.6 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +3 Query: 207 ASGVRHVIVIVVDPRDQIREMGKVAHVQLER*DPQEEHDALVKLLLDPI 353 A GV +IV+ P+D + EMG AH+ P E DA + L +DP+ Sbjct: 70 AIGVESQDLIVISPKD-MDEMGITAHILGNTHKPIEVKDAKIYLEVDPV 117
>UREE_STRT1 (Q5M1G5) Urease accessory protein ureE| Length = 150 Score = 31.2 bits (69), Expect = 1.6 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +3 Query: 207 ASGVRHVIVIVVDPRDQIREMGKVAHVQLER*DPQEEHDALVKLLLDPI 353 A GV +IV+ P+D + EMG AH+ P E DA + L +DP+ Sbjct: 70 AIGVESQDLIVISPKD-MDEMGITAHILGNTHKPIEVKDAKIYLEVDPV 117
>UREE_STRSL (Q55055) Urease accessory protein ureE| Length = 150 Score = 31.2 bits (69), Expect = 1.6 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +3 Query: 207 ASGVRHVIVIVVDPRDQIREMGKVAHVQLER*DPQEEHDALVKLLLDPI 353 A GV +IV+ P+D + EMG AH+ P E DA + L +DP+ Sbjct: 70 AIGVESQDLIVISPKD-MDEMGITAHILGNTHKPIEVKDAKIYLEVDPV 117
>UREE_STRVE (Q3S3T7) Urease accessory protein ureE| Length = 150 Score = 30.4 bits (67), Expect = 2.7 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +3 Query: 213 GVRHVIVIVVDPRDQIREMGKVAHVQLER*DPQEEHDALVKLLLDPI 353 GV +IV+ P+D + EMG AH+ P E DA + L +DP+ Sbjct: 72 GVESQDLIVISPKD-MDEMGITAHILGNTHKPIEVKDAKIYLEVDPV 117
>SVF1_EMENI (Q5BH63) Survival factor 1| Length = 546 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 98 SAWPRQVYIHSPQMELKSTYNPI 166 S WPR V I SPQ+EL + +P+ Sbjct: 413 SPWPRYVTISSPQLELLTKLSPV 435 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,263,907 Number of Sequences: 219361 Number of extensions: 1493099 Number of successful extensions: 4401 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4400 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)