| Clone Name | rbah62c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OXAA_RICPR (Q9ZE97) Inner membrane protein oxaA | 29 | 2.6 | 2 | SPIKE_CVPMI (P33470) Spike glycoprotein precursor (Peplomer prot... | 28 | 5.7 | 3 | MYSB_ACACA (P19706) Myosin heavy chain IB (Myosin heavy chain IL) | 27 | 9.7 | 4 | IAPP_CANFA (P17716) Islet amyloid polypeptide precursor (Amylin) | 27 | 9.7 |
|---|
>OXAA_RICPR (Q9ZE97) Inner membrane protein oxaA| Length = 560 Score = 29.3 bits (64), Expect = 2.6 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = -1 Query: 96 VDRELPNLRTSINVLNQGPLQCIFQGS*EXNY 1 ++R+ +L ++N+L+QGP+ CI + E +Y Sbjct: 202 INRKYISLEKAVNILHQGPIGCIDENLKEYSY 233
>SPIKE_CVPMI (P33470) Spike glycoprotein precursor (Peplomer protein) (E2)| Length = 1449 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 35 CKGPWFNTLIDVLKFGSSLST*NKTKSGCRLLTLET 142 C GP N +DV++F + +T ++ G + +L T Sbjct: 328 CNGPVLNNTVDVIRFNLNFTTNVQSGKGATVFSLNT 363
>MYSB_ACACA (P19706) Myosin heavy chain IB (Myosin heavy chain IL)| Length = 1147 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Frame = -3 Query: 151 Y*SGFKRQQPATAFGFVSSRQRTAKFKNVNQCI----EPGAFAMYISRLL 14 Y ++ +QP + + R K +N+NQC+ E GA S+L+ Sbjct: 67 YRGRYQHEQPPHVYALAEAAYRGVKSENINQCVIISGESGAGKTEASKLV 116
>IAPP_CANFA (P17716) Islet amyloid polypeptide precursor (Amylin)| Length = 89 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -1 Query: 171 CKLQTGTTNLVSSVNNLQPLLVLFQVDRELPNLRTSINVLNQGPL 37 C Q LV + NNL +L V R +I +LN+GPL Sbjct: 40 CATQRLANFLVRTSNNLGAILSPTNVGSNTYGKRNTIEILNRGPL 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,735,365 Number of Sequences: 219361 Number of extensions: 705579 Number of successful extensions: 1521 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1514 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)