Clone Name | rbah62c04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BRCA1_BOVIN (Q864U1) Breast cancer type 1 susceptibility protein... | 28 | 9.1 |
---|
>BRCA1_BOVIN (Q864U1) Breast cancer type 1 susceptibility protein homolog| Length = 1849 Score = 27.7 bits (60), Expect = 9.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 3 NTXKLQTVLSSVQAAATRHNDCPSDSSSLLINRERG 110 N KLQ ++ ++A RH PS SS+ L RG Sbjct: 1398 NLLKLQQEMAELEAVLERHGSQPSHSSASLTADSRG 1433 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,469,143 Number of Sequences: 219361 Number of extensions: 236416 Number of successful extensions: 567 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 80,573,946 effective HSP length: 25 effective length of database: 75,089,921 effective search space used: 1802158104 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)