Clone Name | rbah62c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLNA_HALVO (P43386) Glutamine synthetase (EC 6.3.1.2) (Glutamate... | 29 | 8.5 | 2 | COX3_MYTED (P41775) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) ... | 29 | 8.5 |
---|
>GLNA_HALVO (P43386) Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia| ligase) (GS) Length = 454 Score = 28.9 bits (63), Expect = 8.5 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = +2 Query: 206 ADFDVVYQPMLSPDQVGQKPYTIAAAAMPPL*VKHLPKT*ACRRKPHRPCCCQRLL 373 A D V + + PD V + Y A ++ LPKT A RR+P R Q L Sbjct: 364 AGLDGVEKGLDCPDPVRENIYEFDEAKREEYGIETLPKTSAARRRPRRDEVIQEAL 419
>COX3_MYTED (P41775) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide III) Length = 265 Score = 28.9 bits (63), Expect = 8.5 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 349 TMWFPPACSSFWQMLYS*RRHCC--CCYGIWFLSDLVWRQHWLIHYV 215 T+W + W+ +S +RH C W D+VW W + YV Sbjct: 214 TIWLMVSLVRLWRGEFSSQRHFGFEACIWYWHFVDVVWVALWCLVYV 260 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,754,204 Number of Sequences: 219361 Number of extensions: 1414944 Number of successful extensions: 2894 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2894 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)