Clone Name | rbah62c01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZAN_RABIT (P57999) Zonadhesin (Fragment) | 31 | 1.6 | 2 | YDB4_SCHPO (Q10357) Hypothetical protein C22E12.04 in chromosome I | 29 | 6.2 | 3 | SYFA_RHIME (Q92ST0) Phenylalanyl-tRNA synthetase alpha chain (EC... | 29 | 8.1 | 4 | PPO_VITVI (P43311) Polyphenol oxidase, chloroplast precursor (EC... | 29 | 8.1 |
---|
>ZAN_RABIT (P57999) Zonadhesin (Fragment)| Length = 2282 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 220 PSCHRQELRCAASRAPSCCSDDNTC 294 PSC + RC +RAPS C++ TC Sbjct: 1685 PSCFDPDGRCEGARAPSSCAEGCTC 1709
>YDB4_SCHPO (Q10357) Hypothetical protein C22E12.04 in chromosome I| Length = 297 Score = 29.3 bits (64), Expect = 6.2 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +1 Query: 220 PSCHRQELR-CAASRAPSCCSDD 285 PSC QE + C +S+ PSCCS + Sbjct: 237 PSCCSQEKKSCCSSKKPSCCSQE 259
>SYFA_RHIME (Q92ST0) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 360 Score = 28.9 bits (63), Expect = 8.1 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +2 Query: 191 LAREVSHSSFPAAIDRSSAAQQAERHPVVQMIILVAQSLGA*DHNLSDG*DSESE 355 LARE S P RSS A++ HP+ Q++ + G ++++G D E++ Sbjct: 87 LARETVDISLPV---RSSPAERGRIHPISQIVDEITAIFGDMGFSIAEGPDIETD 138
>PPO_VITVI (P43311) Polyphenol oxidase, chloroplast precursor (EC 1.10.3.1)| (PPO) (Catechol oxidase) Length = 607 Score = 28.9 bits (63), Expect = 8.1 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +3 Query: 195 PVKYRILRSQLPSTGAPLRSKQSAILL 275 PV +I+ QLPS+G+P+R++ +A L+ Sbjct: 131 PVTTKIIDFQLPSSGSPMRTRPAAHLV 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,110,978 Number of Sequences: 219361 Number of extensions: 1292666 Number of successful extensions: 3562 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3562 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)