| Clone Name | rbah61m22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GALT_CLOPE (Q8XKP8) Galactose-1-phosphate uridylyltransferase (E... | 28 | 6.2 | 2 | AMGO2_PONPY (Q5R7M3) Amphoterin-induced protein 2 precursor (AMI... | 28 | 8.1 | 3 | AMGO2_HUMAN (Q86SJ2) Amphoterin-induced protein 2 precursor (AMI... | 28 | 8.1 |
|---|
>GALT_CLOPE (Q8XKP8) Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12)| (Gal-1-P uridylyltransferase) (UDP-glucose--hexose-1-phosphate uridylyltransferase) Length = 498 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 24 YNIMRTXIYIXTDSIHIQACFLEPCWYMNMDIHIFLGTNKKD 149 Y++ ++ YI TD I F P Y MDI I L +KD Sbjct: 115 YSLSKSSNYIRTDRIAKNINFKAPSKYGTMDITINLSKPEKD 156
>AMGO2_PONPY (Q5R7M3) Amphoterin-induced protein 2 precursor (AMIGO-2)| Length = 522 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 153 IYLSYLFLRICVCPCSCTNMARENML 76 I L L+L + CPC C ++NML Sbjct: 410 IVLVLLYLYLTPCPCKCKTKRQKNML 435
>AMGO2_HUMAN (Q86SJ2) Amphoterin-induced protein 2 precursor (AMIGO-2)| (Alivin-1) (Differentially expressed in gastric adenocarcinomas) (DEGA) Length = 522 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 153 IYLSYLFLRICVCPCSCTNMARENML 76 I L L+L + CPC C ++NML Sbjct: 410 IVLVLLYLYLTPCPCKCKTKRQKNML 435 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,009,292 Number of Sequences: 219361 Number of extensions: 633260 Number of successful extensions: 1563 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1561 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)