Clone Name | rbah62b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FTSI_BUCAP (O85297) Peptidoglycan synthetase ftsI (EC 2.4.1.129)... | 30 | 2.1 | 2 | RPOC_ANAMM (Q5PBG3) DNA-directed RNA polymerase beta' chain (EC ... | 29 | 6.0 |
---|
>FTSI_BUCAP (O85297) Peptidoglycan synthetase ftsI (EC 2.4.1.129)| (Peptidoglycan glycosyltransferase 3) (Penicillin-binding protein 3) (PBP-3) Length = 568 Score = 30.4 bits (67), Expect = 2.1 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -1 Query: 223 WQI*TLTKTVTAFLFVVVTEVKLVSLQVITDRRSCYGGTLFSTRICDV 80 W+ TL V FLF+V+ ++++ LQ+I ++ Y G + RI V Sbjct: 17 WRFVTLCSIV--FLFLVILTLRIIFLQIINSKKLAYEGDRRTLRIQSV 62
>RPOC_ANAMM (Q5PBG3) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1415 Score = 28.9 bits (63), Expect = 6.0 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = -1 Query: 196 VTAFLFVVVTEVKLVSLQVITDRRSCYGGTLFSTRICDV 80 V+ + V+ EVKLV+ V+TD+ YG + +R C+V Sbjct: 938 VSNLIAVLDAEVKLVNSNVVTDK---YGNQIVMSRSCEV 973 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,942,152 Number of Sequences: 219361 Number of extensions: 1089930 Number of successful extensions: 2110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2110 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)