| Clone Name | rbah61l22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EWG_DROME (Q24312) DNA-binding protein Ewg (Protein erect wing) | 34 | 0.42 | 2 | METK_BACHD (Q9K7Q9) S-adenosylmethionine synthetase (EC 2.5.1.6)... | 30 | 4.6 | 3 | CD2L7_HUMAN (Q9NYV4) Cell division cycle 2-related protein kinas... | 30 | 7.9 | 4 | METH_MYCLE (Q49775) Methionine synthase (EC 2.1.1.13) (5-methylt... | 30 | 7.9 |
|---|
>EWG_DROME (Q24312) DNA-binding protein Ewg (Protein erect wing)| Length = 733 Score = 33.9 bits (76), Expect = 0.42 Identities = 23/65 (35%), Positives = 28/65 (43%) Frame = -1 Query: 623 LPTGRSLPTTGVDPTHPTTGVTHPAMVIATVQDPHTVTEGGGHAPMTVMFQHTTAGAILQ 444 LP G + GV H G AT+Q ++T+ GH MTV T G I Sbjct: 569 LPDGTTAQVQGVATLHQGEGG-------ATIQTVQSLTDVNGHENMTVDLTETQDGQIYI 621 Query: 443 GTEDG 429 TEDG Sbjct: 622 TTEDG 626
>METK_BACHD (Q9K7Q9) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) (MAT) Length = 399 Score = 30.4 bits (67), Expect = 4.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 419 AAYHHAGATPVAAPWRQKNQGAVLRRK 339 AAY H G T V PW Q ++ +LR++ Sbjct: 372 AAYGHFGRTDVELPWEQTDKAEILRQQ 398
>CD2L7_HUMAN (Q9NYV4) Cell division cycle 2-related protein kinase 7 (EC| 2.7.11.22) (CDC2-related protein kinase 7) (Cdc2-related kinase, arginine/serine-rich) (CrkRS) Length = 1490 Score = 29.6 bits (65), Expect = 7.9 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -3 Query: 636 RSYSPSDRSESPYHRRRSYSPY 571 RS S S RS SPY RRRS SP+ Sbjct: 315 RSGSYSGRSPSPYGRRRSSSPF 336
>METH_MYCLE (Q49775) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1206 Score = 29.6 bits (65), Expect = 7.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 539 ATVQDPHTVTEGGGHAPMTVMFQHTTAGAILQGTEDGVTLAAYHHAG 399 A + +T+ G H P+ V T G +L G+E G LAA G Sbjct: 179 AVLGSRRAMTQAGRHIPVFVHVTVETTGTMLLGSEIGAALAAVEPLG 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,409,382 Number of Sequences: 219361 Number of extensions: 1614169 Number of successful extensions: 5552 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5545 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)