| Clone Name | rbah61k23 |
|---|---|
| Clone Library Name | barley_pub |
>CD48D_ARATH (Q9SCN8) Putative cell division control protein 48 homolog D| (AtCDC48d) (Transitional endoplasmic reticulum ATPase D) Length = 815 Score = 56.6 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQPXAGT 97 RKYQAFAQTLQQSRGFGSEFRFPD P T Sbjct: 756 RKYQAFAQTLQQSRGFGSEFRFPDAPTGTT 785
>CDC48_SOYBN (P54774) Cell division cycle protein 48 homolog (Valosin-containing| protein homolog) (VCP) Length = 807 Score = 51.6 bits (122), Expect = 6e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPD 115 RKYQAFAQTLQQSRGFGSEFRFP+ Sbjct: 758 RKYQAFAQTLQQSRGFGSEFRFPE 781
>CD48A_ARATH (P54609) Cell division control protein 48 homolog A (AtCDC48a)| Length = 809 Score = 50.4 bits (119), Expect = 1e-06 Identities = 26/53 (49%), Positives = 29/53 (54%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQPXAGTXXXXXXXXXXXXXXXXXXXDLYS 28 RKYQAFAQTLQQSRGFGSEFRF + +G DLY+ Sbjct: 757 RKYQAFAQTLQQSRGFGSEFRFENSAGSGATTGVADPFATSAAAAGDDDDLYN 809
>CDC48_CAPAN (Q96372) Cell division cycle protein 48 homolog| Length = 805 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQPXAGT 97 RKYQAFAQTLQQSRGFG+EFRF D T Sbjct: 756 RKYQAFAQTLQQSRGFGTEFRFADTSGGAT 785
>CD48E_ARATH (Q9LZF6) Cell division control protein 48 homolog E (AtCDC48e)| (Transitional endoplasmic reticulum ATPase E) Length = 810 Score = 48.9 bits (115), Expect = 4e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQPXAG 100 RKYQAFAQTLQQSRGFGSEFRF G Sbjct: 757 RKYQAFAQTLQQSRGFGSEFRFDSTAGVG 785
>TERA2_CAEEL (P54812) Transitional endoplasmic reticulum ATPase homolog 2| (p97/CDC48 homolog 2) Length = 810 Score = 45.8 bits (107), Expect = 3e-05 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFP-DQPXAG 100 RKY+ FAQTLQQSRGFG+ F+FP + P AG Sbjct: 762 RKYEMFAQTLQQSRGFGNNFKFPGEAPSAG 791
>TERA1_CAEEL (P54811) Transitional endoplasmic reticulum ATPase homolog 1| (p97/CDC48 homolog 1) Length = 809 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQ 112 RKY+ FAQTLQQSRGFG+ F+FP + Sbjct: 764 RKYEMFAQTLQQSRGFGNNFKFPGE 788
>TERA_RAT (P46462) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 41.6 bits (96), Expect = 6e-04 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQPXAG 100 RKY+ FAQTLQQSRGFGS FRFP G Sbjct: 752 RKYEMFAQTLQQSRGFGS-FRFPSGNQGG 779
>TERA_PIG (P03974) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 41.6 bits (96), Expect = 6e-04 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQPXAG 100 RKY+ FAQTLQQSRGFGS FRFP G Sbjct: 752 RKYEMFAQTLQQSRGFGS-FRFPSGNQGG 779
>TERA_MOUSE (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 41.6 bits (96), Expect = 6e-04 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQPXAG 100 RKY+ FAQTLQQSRGFGS FRFP G Sbjct: 752 RKYEMFAQTLQQSRGFGS-FRFPSGNQGG 779
>TERA_HUMAN (P55072) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 41.6 bits (96), Expect = 6e-04 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQPXAG 100 RKY+ FAQTLQQSRGFGS FRFP G Sbjct: 752 RKYEMFAQTLQQSRGFGS-FRFPSGNQGG 779
>TERA_XENLA (P23787) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) Length = 805 Score = 41.2 bits (95), Expect = 8e-04 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFP 118 RKY+ FAQTLQQSRGFGS FRFP Sbjct: 753 RKYEMFAQTLQQSRGFGS-FRFP 774
>CDC48_YEAST (P25694) Cell division control protein 48| Length = 835 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -2 Query: 186 RKYQAFAQTLQQSRGFGSEFRFPDQPXAGT 97 R+Y+A++Q ++ SRG S F F D P T Sbjct: 775 RRYEAYSQQMKASRGQFSNFNFNDAPLGTT 804 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,879,734 Number of Sequences: 219361 Number of extensions: 139314 Number of successful extensions: 303 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 303 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)