Clone Name | rbah61k01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RM02_MARPO (P26859) Mitochondrial 60S ribosomal protein L2 | 29 | 2.7 | 2 | LYS4_CANGA (Q6FM51) Homoaconitase, mitochondrial precursor (EC 4... | 28 | 4.5 | 3 | UL07_SHV21 (Q01028) Gene 42 protein | 28 | 7.7 |
---|
>RM02_MARPO (P26859) Mitochondrial 60S ribosomal protein L2| Length = 501 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 149 VVMLSHKYHYIWSFRQMPVSNTVTSMHGDHPKALRRY 259 V+ S + YI + + V NTV + HG P L Y Sbjct: 275 VLRTSEPFTYILASENLEVGNTVMNFHGSKPSTLLNY 311
>LYS4_CANGA (Q6FM51) Homoaconitase, mitochondrial precursor (EC 4.2.1.36)| (Homoaconitate hydratase) Length = 689 Score = 28.5 bits (62), Expect = 4.5 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +2 Query: 56 HRAYRDSQINLL*ERAGTTIFKASY*HVFLP--VVMLSHKYHYIWSFRQMPVSNTVTSMH 229 H ++ I L ++A +FKA V+ V+ LS HY+ + VSNTV + Sbjct: 265 HPRINETTIKNLEDKA--KVFKADSDAVYAKKLVIDLSTLTHYVSGPNSVKVSNTVQDLA 322 Query: 230 GDHPKALRRYP*VCTTA 280 D+ K + Y CT A Sbjct: 323 RDNIKINKAYLVSCTNA 339
>UL07_SHV21 (Q01028) Gene 42 protein| Length = 265 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 209 NTVTSMHGDHPKALRRYP*VCTTAAPQGD 295 NTV + H H + L+ + VCTT+ P+ + Sbjct: 233 NTVFTKHLQHKEVLKLFKCVCTTSTPRSN 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,541,771 Number of Sequences: 219361 Number of extensions: 748296 Number of successful extensions: 1201 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)