Clone Name | rbah61j04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GCM1_RAT (Q9Z288) Chorion-specific transcription factor GCMa (Gl... | 30 | 6.9 |
---|
>GCM1_RAT (Q9Z288) Chorion-specific transcription factor GCMa (Glial cells| missing homolog 1) (GCM motif protein 1) Length = 436 Score = 29.6 bits (65), Expect = 6.9 Identities = 25/106 (23%), Positives = 44/106 (41%) Frame = +2 Query: 2 MDXVSWILVQAKLSKKQRPDYRDT*YKLPAQGSVDFLYSSLIYQNSEEITTEMSSRQCVQ 181 M V + L K RP+ + ++P+QGS+ +S +Q ++ + S+ Sbjct: 169 MKKVHMASASSSLRMKGRPEMKGLPGEIPSQGSLPLTWS---FQEGVQLPSGYSTPLIAN 225 Query: 182 FMDKGNKNAKQNVFTTSLIFPSSFAMTKQTETRPP**QLDILKMFK 319 +QN L FP S+ + TE P LD K+++ Sbjct: 226 A-------PQQNSLNDCLSFPKSYDLGGTTELEDPTSTLDPTKLYE 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,712,756 Number of Sequences: 219361 Number of extensions: 1595006 Number of successful extensions: 4013 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4010 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)