| Clone Name | rbah61i10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IAA5_SORBI (P81368) Alpha-amylase inhibitor 5 (SI alpha-5) | 31 | 2.6 | 2 | PTFLB_ECOLI (P32154) Fructose-like PTS system EIIBC component [I... | 30 | 7.6 | 3 | PCRB_SULAC (Q4JAS3) Protein pcrB homolog | 30 | 7.6 | 4 | Y1620_STAAC (Q5HFJ7) UPF0085 protein SACOL1620 | 29 | 9.9 | 5 | MUC1_HYLLA (Q29435) Mucin-1 precursor (MUC-1) | 29 | 9.9 |
|---|
>IAA5_SORBI (P81368) Alpha-amylase inhibitor 5 (SI alpha-5)| Length = 116 Score = 31.2 bits (69), Expect = 2.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +3 Query: 42 PVLLSRCTISYE*LILYCHPTFFNDLKESLVTSYNNRGTC 161 PVL RC E L+ YC +S++T Y R TC Sbjct: 38 PVLKERCCSELEKLVPYCRCGALRTALDSMMTGYEMRPTC 77
>PTFLB_ECOLI (P32154) Fructose-like PTS system EIIBC component [Includes:| Fructose-like phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS system fructose-like EIIB component); Fructose-like permease IIC component (PTS system fructose-like EIIC co Length = 483 Score = 29.6 bits (65), Expect = 7.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 286 GPMQHTAWWLHFIFLEKHRVDYWEGLLG 203 GP+ TAW+ F LEKH D W ++G Sbjct: 321 GPINKTAWFFCFSLLEKHIYD-WYAIVG 347
>PCRB_SULAC (Q4JAS3) Protein pcrB homolog| Length = 257 Score = 29.6 bits (65), Expect = 7.6 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = -3 Query: 342 IIAVVCQQALPTHWLFIGSGQCNTQLGGCILFSWRNIELIIGKVYLAGHVHM 187 II + + LPT +L IG G +G + + NIELI+ A ++ M Sbjct: 120 IIKRIGLEVLPTAYLIIGHGGTAGHIGRARVIPYDNIELIVSYSLAANYMGM 171
>Y1620_STAAC (Q5HFJ7) UPF0085 protein SACOL1620| Length = 272 Score = 29.3 bits (64), Expect = 9.9 Identities = 21/69 (30%), Positives = 34/69 (49%) Frame = +1 Query: 94 VILPSSMTSKNP*LQVTTTEEPARIKSFTAIHVDMACQVNLPNNQLDVSPRK*NATTKLC 273 V+L S TSK P Q KS+ ++V + +V P+ D++P+K C Sbjct: 148 VLLGISRTSKTPLSQYLAH------KSYKVMNVPIVPEVTPPDGLYDINPKK-------C 194 Query: 274 VALARSDEQ 300 +AL S+E+ Sbjct: 195 IALKISEEK 203
>MUC1_HYLLA (Q29435) Mucin-1 precursor (MUC-1)| Length = 475 Score = 29.3 bits (64), Expect = 9.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 445 HSR*TPASHGNHTRKPQLRLIIIHFFTRFGASN 543 HS +P + NH+ PQL + + FF F SN Sbjct: 239 HSTVSPLTSSNHSTSPQLSIGVSFFFLSFHISN 271 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,719,693 Number of Sequences: 219361 Number of extensions: 2026605 Number of successful extensions: 4592 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4592 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)