Clone Name | rbah61h18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CECR1_PIG (P58780) Cat eye syndrome critical region protein 1 ho... | 28 | 7.1 |
---|
>CECR1_PIG (P58780) Cat eye syndrome critical region protein 1 homolog| precursor Length = 510 Score = 28.1 bits (61), Expect = 7.1 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -2 Query: 120 PPPPRPDQIGCPKYLSL--*QKGLCVVTEEKNTTCS*FT 10 PPPP P Q C +++ L +KGL VTE N+ FT Sbjct: 146 PPPPTPKQEECSEWVLLEKFRKGLPNVTEFDNSLLRTFT 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,523,781 Number of Sequences: 219361 Number of extensions: 216077 Number of successful extensions: 2840 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2612 length of database: 80,573,946 effective HSP length: 16 effective length of database: 77,064,170 effective search space used: 1849540080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)