| Clone Name | rbah61g21 |
|---|---|
| Clone Library Name | barley_pub |
>LRC40_XENLA (Q6GPJ5) Leucine-rich repeat-containing protein 40| Length = 605 Score = 33.5 bits (75), Expect = 0.53 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL 542 SNN I +LPD+ G L L+ L L+ NPL Sbjct: 320 SNNDIGSLPDTLGSLPNLKSLQLDGNPL 347 Score = 29.3 bits (64), Expect = 10.0 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPL 542 +NQ+ LPDS G L LE+L++ N L Sbjct: 160 HNQLEELPDSIGHLSILEELDVSNNCL 186
>IPA7_SHIFL (P18014) 60 kDa antigen| Length = 532 Score = 33.1 bits (74), Expect = 0.69 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -3 Query: 619 NQIHALPDSFGRLDKLEKLNLEQNPLS 539 NQI LP+SF +LD ++N+ NPLS Sbjct: 178 NQITTLPESFSQLDSSYRINISGNPLS 204
>LRC40_BRARE (Q7SXW3) Leucine-rich repeat-containing protein 40| Length = 601 Score = 32.7 bits (73), Expect = 0.90 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPLS-MPS 530 +NQ+ +LPDS G L++L+KL L N L+ +PS Sbjct: 112 DNQLSSLPDSIGDLEQLQKLILSHNKLTELPS 143 Score = 32.3 bits (72), Expect = 1.2 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL 542 +NN I +LP G L KL+ L+LE NPL Sbjct: 318 TNNDISSLPCGLGTLPKLKSLSLEGNPL 345
>LRSM1_HUMAN (Q6UWE0) Ubiquitin ligase protein LRSAM1 (EC 6.3.2.-) (Leucine-rich| repeat and sterile alpha motif-containing protein 1) (Tsg101-associated ligase) (hTAL) Length = 723 Score = 32.3 bits (72), Expect = 1.2 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPL 542 +NQ+ ALPD G+L L+ LN+E+N L Sbjct: 90 DNQLTALPDDLGQLTALQVLNVERNQL 116
>LRC57_HUMAN (Q8N9N7) Leucine-rich repeat-containing protein 57| Length = 239 Score = 32.3 bits (72), Expect = 1.2 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPLSMPS 530 S NQI ++PDS G L +E LNL QN +S S Sbjct: 139 SKNQIRSIPDSVGELQVIE-LNLNQNQISQIS 169
>LRSM1_MOUSE (Q80ZI6) Ubiquitin ligase protein LRSAM1 (EC 6.3.2.-) (Leucine-rich| repeat and sterile alpha motif-containing protein 1) (Tsg101-associated ligase) Length = 727 Score = 32.0 bits (71), Expect = 1.5 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -3 Query: 619 NQIHALPDSFGRLDKLEKLNLEQNPLS 539 NQ+ ALPD G+L L+ LN+E+N L+ Sbjct: 91 NQLTALPDDMGQLTVLQVLNVERNQLT 117
>EXS_ARATH (Q9LYN8) Leucine-rich repeat receptor protein kinase EXS precursor| (EC 2.7.11.1) (Extra sporogenous cells protein) (EXCESS MICROSPOROCYTES1 protein) Length = 1192 Score = 32.0 bits (71), Expect = 1.5 Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -3 Query: 625 SNNQIHA-LPDSFGRLDKLEKLNLEQNPLSMP 533 +NNQ++ +P+SFG L L KLNL +N L P Sbjct: 660 ANNQLNGHIPESFGLLGSLVKLNLTKNKLDGP 691
>LRC57_RAT (Q5FVI3) Leucine-rich repeat-containing protein 57| Length = 239 Score = 31.6 bits (70), Expect = 2.0 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPLSMPS 530 S NQI ++PD+ G L +E LNL QN +S S Sbjct: 139 SKNQIRSIPDTVGELQAIE-LNLNQNQISQIS 169 Score = 29.6 bits (65), Expect = 7.6 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL 542 +NN + LP SFG+L L+ L+L N L Sbjct: 93 NNNHLRELPSSFGQLSALKTLSLSGNQL 120
>LRC57_MOUSE (Q9D1G5) Leucine-rich repeat-containing protein 57| Length = 239 Score = 31.6 bits (70), Expect = 2.0 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPLSMPS 530 S NQI ++PD+ G L +E LNL QN +S S Sbjct: 139 SKNQIRSIPDTVGELQAIE-LNLNQNQISQLS 169
>SHOC2_MOUSE (O88520) Leucine-rich repeat protein SHOC-2 (Ras-binding protein| Sur-8) Length = 582 Score = 31.2 bits (69), Expect = 2.6 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL-SMPS 530 SNN + LP G L KL +L+LE+N L S+P+ Sbjct: 433 SNNLLKKLPHGLGNLRKLRELDLEENKLESLPN 465
>SHOC2_HUMAN (Q9UQ13) Leucine-rich repeat protein SHOC-2 (Ras-binding protein| Sur-8) Length = 582 Score = 31.2 bits (69), Expect = 2.6 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL-SMPS 530 SNN + LP G L KL +L+LE+N L S+P+ Sbjct: 433 SNNLLKKLPHGLGNLRKLRELDLEENKLESLPN 465
>LRC59_XENLA (Q8AVS8) Leucine-rich repeat-containing protein 59| Length = 307 Score = 31.2 bits (69), Expect = 2.6 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL-SMP 533 S NQI LP FGRL L+ L+L QN L S+P Sbjct: 70 SKNQIVQLPSEFGRLMNLQHLDLLQNHLMSLP 101
>LRC18_HUMAN (Q8N456) Leucine-rich repeat-containing protein 18| Length = 261 Score = 30.8 bits (68), Expect = 3.4 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPLSMP 533 +N ++ +P S +L KL+KLN+++NP P Sbjct: 153 DNLLNNIPVSISKLPKLKKLNIKRNPFPKP 182
>LRC59_XENTR (Q6NX28) Leucine-rich repeat-containing protein 59| Length = 308 Score = 30.4 bits (67), Expect = 4.5 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQN 548 S NQI LP FGRL L+ L+L QN Sbjct: 70 SKNQIAQLPSEFGRLVNLQHLDLLQN 95
>LRC40_XENTR (Q5M8G4) Leucine-rich repeat-containing protein 40| Length = 605 Score = 30.4 bits (67), Expect = 4.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL 542 SNN + +LP + G L L+ L LE NPL Sbjct: 320 SNNDLGSLPCTLGSLPNLKSLQLEGNPL 347 Score = 29.3 bits (64), Expect = 10.0 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPL 542 +NQ+ LPDS G L LE+L++ N L Sbjct: 160 HNQLEELPDSIGHLSILEELDVSNNCL 186
>CYAA_SACKL (P23466) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 1839 Score = 30.4 bits (67), Expect = 4.5 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPLS 539 S N+IH+LP S +L KL K+NL N L+ Sbjct: 757 SYNKIHSLPVSINQLVKLAKMNLFNNRLT 785
>LAP1_DROME (Q9V780) Protein lap1| Length = 849 Score = 30.4 bits (67), Expect = 4.5 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 5/35 (14%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQN-----PLSM 536 +NNQ+ ALP + G L K++ LN+ N P+SM Sbjct: 347 ANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSM 381
>LRRC1_HUMAN (Q9BTT6) Leucine-rich repeat-containing protein 1 (LAP and no PDZ| protein) (LANO adapter protein) Length = 524 Score = 30.4 bits (67), Expect = 4.5 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL-SMP 533 + NQ+ LP S G+L KL LN ++N L S+P Sbjct: 297 TENQLLTLPKSIGKLKKLSNLNADRNKLVSLP 328
>LRC40_CHICK (Q5ZLN0) Leucine-rich repeat-containing protein 40| Length = 603 Score = 30.4 bits (67), Expect = 4.5 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPLS 539 +N++ LPD FG+L LE+L+L N L+ Sbjct: 160 HNELSHLPDGFGQLVSLEELDLSNNHLT 187 Score = 29.3 bits (64), Expect = 10.0 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPL 542 +NQ+ +LP + G+L+ L+KL++ N L Sbjct: 114 DNQLTSLPSALGQLENLQKLDVSHNKL 140
>POPC_RALSO (Q9RBS2) Protein popC| Length = 1024 Score = 30.0 bits (66), Expect = 5.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQN 548 SN Q+ ALP S G+L L+ L L+ N Sbjct: 598 SNTQLRALPSSIGKLSNLKGLTLKNN 623
>PHLPP_CAEEL (Q09564) Protein phosphatase PHLPP-like protein (EC 3.1.3.16)| Length = 1036 Score = 30.0 bits (66), Expect = 5.8 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPLS 539 SNNQ+ LPDS L L+ L++ N S Sbjct: 251 SNNQLDTLPDSISELQNLQSLDISFNQFS 279
>LRC57_XENLA (Q6INV3) Leucine-rich repeat-containing protein 57| Length = 238 Score = 30.0 bits (66), Expect = 5.8 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPLS 539 +NN+I LPD +L KLE L+L N +S Sbjct: 69 NNNRISRLPDELCKLKKLETLHLNGNQIS 97
>LRC40_PONPY (Q5RFE9) Leucine-rich repeat-containing protein 40| Length = 602 Score = 29.6 bits (65), Expect = 7.6 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL-SMPS 530 SNN++ +P SF L L +LNL N L S+P+ Sbjct: 182 SNNRLTTVPASFSSLSSLVRLNLSSNELKSLPA 214
>LRC40_MOUSE (Q9CRC8) Leucine-rich repeat-containing protein 40| Length = 602 Score = 29.6 bits (65), Expect = 7.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPLSM 536 +NQ+ +LP + LD L+KLN+ N L + Sbjct: 114 DNQLTSLPSAIRELDNLQKLNVSHNKLKI 142
>LRC40_MACFA (Q4R3P6) Leucine-rich repeat-containing protein 40| Length = 602 Score = 29.6 bits (65), Expect = 7.6 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL-SMPS 530 SNN++ +P SF L L +LNL N L S+P+ Sbjct: 182 SNNRLTTVPASFSSLSSLVRLNLSSNQLKSLPA 214
>RLK5_ARATH (P47735) Receptor-like protein kinase 5 precursor (EC 2.7.11.1)| Length = 999 Score = 29.6 bits (65), Expect = 7.6 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPLS 539 NN +P SFG KLE LNL N LS Sbjct: 149 NNLSDTIPSSFGEFRKLESLNLAGNFLS 176
>FLII_CAEEL (P34268) Protein flightless-1 homolog| Length = 1257 Score = 29.6 bits (65), Expect = 7.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPLS 539 SNN++ LP RL L+ L L NPL+ Sbjct: 158 SNNKLDMLPPQIRRLSMLQSLKLSNNPLN 186
>LAP4_MOUSE (Q80U72) LAP4 protein (Scribble homolog protein)| Length = 1612 Score = 29.6 bits (65), Expect = 7.6 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPLSM 536 + N + ALP S G+L KL LN+++N L + Sbjct: 297 TENLLTALPHSLGKLTKLTNLNVDRNHLEV 326
>OR4C3_HUMAN (Q8NH37) Olfactory receptor 4C3 (Olfactory receptor OR11-98)| Length = 302 Score = 29.3 bits (64), Expect = 10.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 202 IIVFLVTQRDAHTHPYTTLPSEAGFGVYFPILTP 101 + +F V + HP++TLP + +++ ILTP Sbjct: 245 VALFFVPCIFTYVHPFSTLPIDKNMALFYGILTP 278
>LRC40_HUMAN (Q9H9A6) Leucine-rich repeat-containing protein 40| Length = 602 Score = 29.3 bits (64), Expect = 10.0 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL-SMPS 530 SNN + +P SF L L +LNL N L S+P+ Sbjct: 182 SNNHLTTVPASFSSLSSLVRLNLSSNELKSLPA 214
>IPO4_HUMAN (Q8TEX9) Importin-4 (Importin 4b) (Imp4b) (Ran-binding protein 4)| (RanBP4) Length = 1081 Score = 29.3 bits (64), Expect = 10.0 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +2 Query: 371 DAARQPSLGSR-RLQALCCCCFCHA--PLFFLKQRIKPPL*HVLF 496 + AR +LG+ R++ LCC F LK R+ PPL H LF Sbjct: 252 EVARNVALGNAIRIRILCCLTFLVKVKSKALLKNRLLPPLLHTLF 296
>NPFF1_HUMAN (Q9GZQ6) Neuropeptide FF receptor 1 (G-protein coupled receptor| 147) (RFamide-related peptide receptor OT7T022) Length = 430 Score = 29.3 bits (64), Expect = 10.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 224 LRNSRPGNHCVPSDSERCTHTPLHHPA 144 LRN R +H +P + C+H PL PA Sbjct: 401 LRNGRVAHHGLPREGPGCSHLPLTIPA 427
>LRC18_RAT (Q66HD6) Leucine-rich repeat-containing protein 18| Length = 256 Score = 29.3 bits (64), Expect = 10.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 622 NNQIHALPDSFGRLDKLEKLNLEQNPLSMP 533 +N + ++P +L KL+KLN+++NP P Sbjct: 153 DNLLTSIPAGISKLPKLKKLNVKRNPFPKP 182
>LRCH4_HUMAN (O75427) Leucine-rich repeats and calponin homology| domain-containing protein 4 (Leucine-rich neuronal protein) Length = 683 Score = 29.3 bits (64), Expect = 10.0 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 625 SNNQIHALPDSFGRLDKLEKLNLEQNPL-SMPS 530 SNN++ ALP G L L +L++ N L S+PS Sbjct: 144 SNNKLGALPPDIGTLGSLRQLDVSSNELQSLPS 176 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,899,001 Number of Sequences: 219361 Number of extensions: 1609748 Number of successful extensions: 4227 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 3894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4208 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)