Clone Name | rbah61g16 |
---|---|
Clone Library Name | barley_pub |
>MAD18_ORYSA (Q6Z4G0) MADS-box transcription factor 18 (OsMADS18) (MADS-box| protein 2) (OsMADS2) (MADS-box protein 28) (OsMADS28) (FDRMADS7) Length = 249 Score = 42.4 bits (98), Expect = 0.001 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 488 QSRGGGDPEPQXSPAQANNSNLPPXMLRT 402 Q RG G+ E Q SPAQA NS LPP MLRT Sbjct: 218 QPRGSGESEAQPSPAQAGNSKLPPWMLRT 246
>SHC3_RAT (O70143) SHC transforming protein 3 (SH2 domain protein C3) (Src| homology 2 domain-containing transforming protein C3) (Neuronal Shc) (N-Shc) Length = 594 Score = 33.1 bits (74), Expect = 0.55 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = -2 Query: 553 RTAQDSMAPXNIGYLCFHLGHINLEEEGIQNLSXPQHKQTTAICPRXCSAPS 398 R A D P ++G+L + H+ L G++ LS ++ A CSAPS Sbjct: 51 RKAPDD-GPGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPS 101
>SHC3_HUMAN (Q92529) SHC transforming protein 3 (SH2 domain protein C3) (Src| homology 2 domain-containing transforming protein C3) (Neuronal Shc) (N-Shc) (Protein Rai) Length = 594 Score = 33.1 bits (74), Expect = 0.55 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = -2 Query: 553 RTAQDSMAPXNIGYLCFHLGHINLEEEGIQNLSXPQHKQTTAICPRXCSAPS 398 R A D P ++G+L + H+ L G++ LS ++ A CSAPS Sbjct: 54 RKAPDD-GPGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPS 104
>DML2_ARATH (Q9SR66) DEMETER-like protein 2| Length = 1309 Score = 31.6 bits (70), Expect = 1.6 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 10/105 (9%) Frame = +1 Query: 1 SFNNNIKRRQRPFAFLQRMEYKNRVNV*NHTANPL------KLTHESPTTRSCSSISEKK 162 S NN++ +P + +R+ +N + N + L + S S SS+S + Sbjct: 32 SIFNNMQHNHQPDSDRRRLSLENLPGLYNMSCTQLLALANATVATGSSIGASSSSLSSQH 91 Query: 163 GTETW----KQDTAPYSAGKAQDRKTPFTL*QRHMVLLVATPEAI 285 T++W K D+ P++ K Q ++ + Q+ + L TPE + Sbjct: 92 PTDSWINSWKMDSNPWTLSKMQKQQYDVSTPQKFLCDLNLTPEEL 136
>POL_HV1MA (P04588) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix protein| p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1439 Score = 30.0 bits (66), Expect = 4.6 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +2 Query: 146 RSAKKKELKRGNKTLLPIVQEKL----KTGRPHSPCSKDTWSYWW 268 +SA ++K+ + + I QE + KT + P K+TW WW Sbjct: 949 KSAHTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEAWW 993
>POL_HV1OY (P20892) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix protein| p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1433 Score = 29.3 bits (64), Expect = 7.9 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = +2 Query: 146 RSAKKKELKRGNKTLLPIVQEKL----KTGRPHSPCSKDTWSYWW 268 R A ++K+ + + I QE + KT + P K+TW WW Sbjct: 943 RGAHTNDVKQLTEAVQKITQESIVIWGKTPKFKLPIQKETWEAWW 987
>AEPE_BPA18 (Q37976) L-alanyl-D-glutamate peptidase (EC 3.4.-.-)| Length = 281 Score = 29.3 bits (64), Expect = 7.9 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 179 NKTLLPIVQEKLKTGRPHSPCSKDTW 256 N TLL KLK G+PH+P SK+T+ Sbjct: 189 NTTLLA----KLKAGKPHTPASKNTY 210 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,668,900 Number of Sequences: 219361 Number of extensions: 1863030 Number of successful extensions: 5201 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5201 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)