| Clone Name | rbah61g13 |
|---|---|
| Clone Library Name | barley_pub |
>LEUNG_ARATH (Q9FUY2) Transcriptional corepressor LEUNIG| Length = 931 Score = 43.1 bits (100), Expect = 5e-04 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 566 IAALAASNASGLVASVSHDKLVKLWK 489 I +LA S A+GLVAS SHDKLVKLWK Sbjct: 906 ITSLAVSTATGLVASASHDKLVKLWK 931
>SPEG_HUMAN (Q15772) Striated muscle preferentially expressed protein kinase (EC| 2.7.11.1) (Aortic preferentially expressed protein 1) (APEG-1) Length = 3223 Score = 30.4 bits (67), Expect = 3.6 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 7/64 (10%) Frame = -2 Query: 302 CHPSCCRCPWIGL-----TILVECTILVVACANSRVLLSL--TGHKHRSLYVFSDCIFLN 144 C P+ C P I ++ E ++++V+C + R LLS+ G +H LY S L Sbjct: 2605 CLPAACPAPHISWMKDKKSLRSEPSVIIVSCKDGRQLLSIPRAGKRHAGLYECSATNVLG 2664 Query: 143 CVCS 132 + S Sbjct: 2665 SITS 2668
>GBLP_RAT (P63245) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 30.4 bits (67), Expect = 3.6 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 566 IAALAASNASGLVASVSHDKLVKLWK*YQVATFLLRQTSWSLRTSVVQFQP 414 + ++A S+ + + S S DK +KLW V + ++ S S S V+F P Sbjct: 107 VLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSP 157
>GBLP_PIG (P63246) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 30.4 bits (67), Expect = 3.6 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 566 IAALAASNASGLVASVSHDKLVKLWK*YQVATFLLRQTSWSLRTSVVQFQP 414 + ++A S+ + + S S DK +KLW V + ++ S S S V+F P Sbjct: 107 VLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSP 157
>GBLP_MOUSE (P68040) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (p205) (12-3) Length = 316 Score = 30.4 bits (67), Expect = 3.6 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 566 IAALAASNASGLVASVSHDKLVKLWK*YQVATFLLRQTSWSLRTSVVQFQP 414 + ++A S+ + + S S DK +KLW V + ++ S S S V+F P Sbjct: 107 VLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSP 157
>GBLP_MACFA (Q4R7Y4) Guanine nucleotide-binding protein beta subunit 2-like 1| Length = 316 Score = 30.4 bits (67), Expect = 3.6 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 566 IAALAASNASGLVASVSHDKLVKLWK*YQVATFLLRQTSWSLRTSVVQFQP 414 + ++A S+ + + S S DK +KLW V + ++ S S S V+F P Sbjct: 107 VLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSP 157
>GBLP_HUMAN (P63244) Guanine nucleotide-binding protein beta subunit 2-like 1| (Guanine nucleotide-binding protein beta subunit-like protein 12.3) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 30.4 bits (67), Expect = 3.6 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 566 IAALAASNASGLVASVSHDKLVKLWK*YQVATFLLRQTSWSLRTSVVQFQP 414 + ++A S+ + + S S DK +KLW V + ++ S S S V+F P Sbjct: 107 VLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSP 157
>GBLP_BOVIN (P63243) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 30.4 bits (67), Expect = 3.6 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 566 IAALAASNASGLVASVSHDKLVKLWK*YQVATFLLRQTSWSLRTSVVQFQP 414 + ++A S+ + + S S DK +KLW V + ++ S S S V+F P Sbjct: 107 VLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSP 157
>GBLP_CHICK (P63247) Guanine nucleotide-binding protein beta subunit 2-like 1| (Guanine nucleotide-binding protein beta subunit-like protein 12.3) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 317 Score = 30.4 bits (67), Expect = 3.6 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 566 IAALAASNASGLVASVSHDKLVKLWK*YQVATFLLRQTSWSLRTSVVQFQP 414 + ++A S+ + + S S DK +KLW V + ++ S S S V+F P Sbjct: 108 VLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSP 158
>SPEG_MOUSE (Q62407) Striated muscle-specific serine/threonine protein kinase (EC| 2.7.11.1) (Aortic preferentially expressed protein 1) (APEG-1) Length = 3262 Score = 29.6 bits (65), Expect = 6.2 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 7/64 (10%) Frame = -2 Query: 302 CHPSCCRCPWIGL-----TILVECTILVVACANSRVLLSL--TGHKHRSLYVFSDCIFLN 144 C P+ C P I ++ E ++++V+C + R LLS+ G +H LY S L Sbjct: 2608 CLPAACPAPRISWMKDKQSLRSEPSVVIVSCKDGRQLLSIPRAGKRHAGLYECSATNVLG 2667 Query: 143 CVCS 132 + S Sbjct: 2668 SITS 2671
>VL1_HPVME (P27964) Major capsid protein L1| Length = 505 Score = 29.6 bits (65), Expect = 6.2 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 493 GSDIR*QPSFYVKQVGPCGHLSSSSSQRF 407 G+DIR PS YV P G + SS SQ F Sbjct: 279 GTDIRDSPSSYVYAPSPSGSMVSSDSQLF 307
>Y130_MYCGE (P47376) UPF0144 protein MG130| Length = 484 Score = 29.3 bits (64), Expect = 8.1 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = -3 Query: 193 VTSTEAFMYFLTAFFSIAFALISPFSLCAPKFSKSDVSACCLKAYV*FRYSI 38 +T++ A ++F T+FF+ F +I F+L CL AY+ F+Y I Sbjct: 5 ITNSIAQLFFNTSFFAFLFLIIIAFNL-------------CLFAYLYFQYRI 43
>VL1_HPV68 (P54669) Major capsid protein L1| Length = 505 Score = 29.3 bits (64), Expect = 8.1 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 493 GSDIR*QPSFYVKQVGPCGHLSSSSSQRF 407 G+DIR PS YV P G + SS SQ F Sbjct: 279 GTDIRETPSSYVYAPSPSGSMVSSDSQLF 307 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,898,439 Number of Sequences: 219361 Number of extensions: 1555620 Number of successful extensions: 3549 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3544 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)