Clone Name | rbah61f11 |
---|---|
Clone Library Name | barley_pub |
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 58.5 bits (140), Expect = 4e-09 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNNLLTVISGAAERVPS 164 GEGP ENL HLSDPFGNNLLTVI+G AER P+ Sbjct: 247 GEGPVENLAKHLSDPFGNNLLTVIAGTAERAPT 279
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNNLLT 197 G GP++NL HL+DP NN+LT Sbjct: 247 GVGPYQNLLDHLADPVNNNVLT 268
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNNLL 200 G+GPFENL HLSDP+ N ++ Sbjct: 227 GKGPFENLLQHLSDPWHNTIV 247
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 33.5 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNNLLTVI 191 G GP ENL HL+DP+ NN+ VI Sbjct: 215 GTGPLENLATHLADPWHNNIGDVI 238
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HLSDP NN Sbjct: 238 GKGPLENLADHLSDPVNNN 256
>CB21_RAPSA (P14584) Chlorophyll a-b binding of LHCII type 1 protein| (Chlorophyll a-b binding of LHCII type I protein) (CAB) (LHCP) (Fragment) Length = 124 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 94 GKGPLENLADHLADPVNNN 112
>CB2C_LYCES (P14275) Chlorophyll a-b binding protein 1C, chloroplast precursor| (LHCII type I CAB-1C) (LHCP) (Fragments) Length = 265 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 235 GKGPLENLADHLADPVNNN 253
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 235 GKGPLENLADHLADPVNNN 253
>CB2A_LYCES (P14274) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type I CAB-1A) (LHCP) (Fragments) Length = 265 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 235 GKGPLENLADHLADPVNNN 253
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 235 GKGPLENLADHLADPVNNN 253
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 235 GKGPLENLADHLADPVNNN 253
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 235 GKGPLENLADHLADPVNNN 253
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 176 GKGPLENLADHLADPVNNN 194
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 225 GKGPLENLADHLADPVNNN 243
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 234 GKGPIENLADHLTDPVNNN 252
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 234 GKGPLENLADHLADPVNNN 252
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 226 GKGPLENLADHLADPVNNN 244
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 234 GKGPLENLADHLADPVNNN 252
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 239 GKGPLENLADHLADPVNNN 257
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 237 GKGPLENLADHLADPVNNN 255
>CB2D_LYCES (P10707) Chlorophyll a-b binding protein 1D (LHCII type I CAB-1D)| (LHCP) (Fragment) Length = 116 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 86 GKGPLENLADHLADPVNNN 104
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 237 GKGPLENLADHLADPVNNN 255
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 248 GKGPIENLADHLADPVNNN 266
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 248 GKGPIENLADHLADPVNNN 266
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 237 GKGPLENLADHLADPVNNN 255
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 237 GKGPLENLADHLADPVNNN 255
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 237 GKGPLENLADHLADPVNNN 255
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 237 GKGPLENLADHLADPVNNN 255
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 237 GKGPLENLADHLADPVNNN 255
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 237 GKGPIENLADHLADPVNNN 255
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 198 GKGPLENLADHLADPVNNN 216
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 237 GKGPIENLADHLADPVNNN 255
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 236 GKGPLENLADHLADPVNNN 254
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 236 GKGPLENLADHLADPVNNN 254
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 236 GKGPLENLADHLADPVNNN 254
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 236 GKGPLENLADHLADPVNNN 254
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 236 GKGPLENLADHLADPVNNN 254
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 231 GKGPLENLADHLADPVNNN 249
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 244 GKGPIENLADHLADPVNNN 262
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 30.8 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 235 GKGPLENLADHIADPVNNN 253
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 30.8 bits (68), Expect = 0.95 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 235 GKGPIENLFDHLADPVANN 253
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 30.8 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 232 GKGPLENLADHIADPVNNN 250
>LH18_EUGGR (P08976) Light-harvesting complex I LH38 proteins precursor| [Contains: LH38 protein 1; LH38 protein 2; LH38 protein 3] (Fragment) Length = 530 Score = 30.8 bits (68), Expect = 0.95 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNNLLTVI-----SGAAE 176 GE P NL AHL++P G N+ T + SGA E Sbjct: 336 GESPLANLSAHLANPIGANITTNLAMFASSGAKE 369
>CB22_PINSY (P15192) Chlorophyll a-b binding protein type 2 member 2| (Chlorophyll a-b binding protein type II 2) (CAB) (LHCP) (Fragment) Length = 150 Score = 30.8 bits (68), Expect = 0.95 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 120 GKGPIENLYDHLADPVANN 138
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 30.8 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 234 GKGPIENLADHIADPVANN 252
>CB2F_LYCES (P14277) Chlorophyll a-b binding protein 3B, chloroplast precursor| (LHCII type I CAB-3B) (LHCP) (Fragments) Length = 267 Score = 30.8 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 237 GKGPLENLADHIADPVNNN 255
>CB2E_LYCES (P14276) Chlorophyll a-b binding protein 3A, chloroplast precursor| (LHCII type I CAB-3A) (LHCP) (Fragments) Length = 267 Score = 30.8 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 237 GKGPLENLADHIADPVNNN 255
>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast| precursor (CAB) (LHCP) Length = 266 Score = 30.8 bits (68), Expect = 0.95 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 236 GKGPIENLYDHLADPVANN 254
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 235 GKGPIENLSDHINDPVANN 253
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 207 GKGPIENLSDHIADPVANN 225
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 238 GKGPLENLNDHLADPVANN 256
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL DP NN Sbjct: 238 GKGPLENLFDHLDDPVANN 256
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL DP NN Sbjct: 237 GKGPLENLADHLVDPVNNN 255
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL++P NN Sbjct: 215 GKGPLENLADHLAEPVNNN 233
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP +NL HL+DP NN Sbjct: 237 GKGPLDNLVDHLADPVNNN 255
>CB21_EUGGR (P12327) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 127 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNNLLTVI 191 GEGP EN HL DP +N LT + Sbjct: 92 GEGPVENWLYHLQDPSAHNGLTAL 115
>LH15_EUGGR (P08975) Light-harvesting complex I LH35 proteins precursor| [Contains: LH35 protein 1; LH35 protein 2] (Fragment) Length = 331 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNNLLTVIS 188 GE P NL AH ++P G N+ T ++ Sbjct: 307 GESPLANLAAHFANPVGANITTTLA 331
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 235 GKGPIENLYDHVADPVANN 253
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 235 GKGPIENLFDHVADPVANN 253
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+DP NN Sbjct: 235 GKGPIENLSDHLADPAVNN 253
>USE1_HUMAN (Q9NZ43) USE1-like protein (Hematopoietic stem/progenitor cells| protein MDS032) (Putative MAPK-activating protein PM26) (Protein p31) Length = 259 Score = 29.6 bits (65), Expect = 2.1 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +3 Query: 54 LFPGKIHTAHHAASHARMQLSINSRRRRTGNQRPAHRLGTLSAAPEMTVSR 206 L PG++ T A + + SR R T R + LGT SA PEM V + Sbjct: 90 LAPGRVPTTARERVPATKTVHLQSRARYTSEMR-SELLGTDSAEPEMDVRK 139
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL H++DP NN Sbjct: 233 GKGPIENLFDHVADPVANN 251
>DUS10_MOUSE (Q9ESS0) Dual specificity protein phosphatase 10 (EC 3.1.3.48) (EC| 3.1.3.16) (Mitogen-activated protein kinase phosphatase 5) (MAP kinase phosphatase 5) (MKP-5) Length = 483 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 77 STSCCIARTHAAEHQQPTAADGQSTASSQAG 169 STSCC T+ +HQ T A TA++ G Sbjct: 77 STSCCTVATYDKDHQAQTQAIAAGTATTAIG 107
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL +P NN Sbjct: 235 GKGPLENLLDHLDNPVANN 253
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP +NL HL+DP NN Sbjct: 226 GKGPIQNLADHLADPGTNN 244
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL+ P NN Sbjct: 233 GKGPLENLADHLAGPVNNN 251
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP E+L H++DP NN Sbjct: 236 GKGPLEDLADHIADPVNNN 254
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP +NL H++DP NN Sbjct: 235 GKGPIQNLYDHVADPVANN 253
>NMDE1_RAT (Q00959) Glutamate [NMDA] receptor subunit epsilon 1 precursor| (N-methyl D-aspartate receptor subtype 2A) (NR2A) (NMDAR2A) Length = 1464 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 1 MFLLPLIIYTYGTFVLSYFSPVKFTQHI 84 MF++ LI+ FV YFSPV + +++ Sbjct: 561 MFVMLLIVSAIAVFVFEYFSPVGYNRNL 588
>NMDE1_PANTR (Q5IS45) Glutamate [NMDA] receptor subunit epsilon 1 precursor| (N-methyl D-aspartate receptor subtype 2A) (NR2A) (NMDAR2A) Length = 1464 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 1 MFLLPLIIYTYGTFVLSYFSPVKFTQHI 84 MF++ LI+ FV YFSPV + +++ Sbjct: 561 MFVMLLIVSAIAVFVFEYFSPVGYNRNL 588
>NMDE1_MOUSE (P35436) Glutamate [NMDA] receptor subunit epsilon 1 precursor| (N-methyl D-aspartate receptor subtype 2A) (NR2A) (NMDAR2A) Length = 1464 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 1 MFLLPLIIYTYGTFVLSYFSPVKFTQHI 84 MF++ LI+ FV YFSPV + +++ Sbjct: 561 MFVMLLIVSAIAVFVFEYFSPVGYNRNL 588
>NMDE1_HUMAN (Q12879) Glutamate [NMDA] receptor subunit epsilon 1 precursor| (N-methyl D-aspartate receptor subtype 2A) (NR2A) (NMDAR2A) (hNR2A) Length = 1464 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 1 MFLLPLIIYTYGTFVLSYFSPVKFTQHI 84 MF++ LI+ FV YFSPV + +++ Sbjct: 561 MFVMLLIVSAIAVFVFEYFSPVGYNRNL 588
>CB2_DUNSA (P20865) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 273 Score = 28.1 bits (61), Expect = 6.2 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 262 GEGPFENLCAHLSDPFGNN 206 G+GP ENL HL++P NN Sbjct: 244 GKGPIENLTDHLANPAENN 262
>MURD_XYLFA (Q9PEB0) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 468 Score = 27.7 bits (60), Expect = 8.1 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = +3 Query: 84 HAASHARMQLSINSRRRRTGNQRPAHRLGTLSAAPEMTVSRLLPKGSLRWAHR 242 H H Q IN + RP R+ L+AA S LP+ LRW +R Sbjct: 198 HLDWHGSEQRYINDKLSLVTVTRP--RIALLNAADPRLASLALPQSDLRWFNR 248
>DCNL4_BRARE (Q5RHX6) DCN1-like protein 4 (Defective in cullin neddylation| protein 1-like protein 4) (DCUN1 domain-containing protein 4) Length = 280 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = +2 Query: 38 HSYSHTFPR*N--------SHSTSCCIARTHAAEHQQPTAADGQSTASSQ 163 H HT R N SH T+CC + ++PTA D S S+ Sbjct: 21 HKIYHTLHRLNLTEDVGPESHGTACCSRAMPPRKKRRPTAGDDLSAKKSR 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,997,107 Number of Sequences: 219361 Number of extensions: 569870 Number of successful extensions: 1768 Number of sequences better than 10.0: 75 Number of HSP's better than 10.0 without gapping: 1739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1768 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)