| Clone Name | rbah61f09 |
|---|---|
| Clone Library Name | barley_pub |
>RB_MOUSE (P13405) Retinoblastoma-associated protein (PP105) (RB)| Length = 921 Score = 34.7 bits (78), Expect = 0.13 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +3 Query: 156 ESNLSPKMEQHLQHCFQRSLSPRHHLPWLCPSPILHLVHSS--GQNPKNHSP 305 E+NL+ +M +HL+ C R + L WL SP+ L+ S G+ P N P Sbjct: 533 EANLTREMIKHLERCEHRIM---ESLAWLSDSPLFDLIKQSKDGEGPDNLEP 581
>SEM4D_HUMAN (Q92854) Semaphorin-4D precursor (Leukocyte activation antigen| CD100) (BB18) (A8) (GR3) Length = 862 Score = 32.7 bits (73), Expect = 0.48 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 267 VHSSGQNPKNHSPLALCMHAHICQTC*HKRSNFPVAWSPPTRS-LGFHQTRSQS 425 V++ + +PLA C C+ C R + AWSPPT + + HQT S S Sbjct: 487 VYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPY-CAWSPPTATCVALHQTESPS 539
>RB_RAT (P33568) Retinoblastoma-associated protein (PP105) (RB) (Fragment)| Length = 899 Score = 31.2 bits (69), Expect = 1.4 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +3 Query: 156 ESNLSPKMEQHLQHCFQRSLSPRHHLPWLCPSPILHLVHSS--GQNP 290 E+NL+ +M +HL+ C R + L WL SP+ L+ S G+ P Sbjct: 511 EANLTREMIKHLERCEHRIM---ESLAWLSDSPLFDLIKQSKDGEGP 554
>LDOX_VITVI (P51093) Leucoanthocyanidin dioxygenase (EC 1.14.11.19) (LDOX)| (Leucocyanidin oxygenase) (Leucoanthocyanidin hydroxylase) Length = 362 Score = 28.9 bits (63), Expect = 6.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 195 HCFQRSLSPRHHLPWLCPSPILHLVHSSGQNPKNHSP 305 HC +R L HH L P P + SSG+ + +SP Sbjct: 323 HCQRRCLRLSHHSSHLAPFPNIFSTSSSGRPRRLYSP 359
>NECP2_RAT (Q6P756) Adaptin ear-binding coat-associated protein 2 (NECAP-2)| Length = 263 Score = 28.5 bits (62), Expect = 9.1 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 179 GATSSTLLPEVFESPASSSLVVPVTNSSFSAL*WTESKESFTSCA 313 G STL+P E + SLV PV+ S + W +SK + + A Sbjct: 193 GGKMSTLIPPSGEQFSGGSLVQPVSGSGGATELWPQSKPAAAATA 237 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,607,805 Number of Sequences: 219361 Number of extensions: 1598350 Number of successful extensions: 3798 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3674 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3798 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)