Clone Name | rbah61e05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RBBP4_BRARE (Q6P3H7) Histone-binding protein RBBP4 (Retinoblasto... | 29 | 5.2 |
---|
>RBBP4_BRARE (Q6P3H7) Histone-binding protein RBBP4 (Retinoblastoma-binding| protein 4) (RBBP-4) Length = 423 Score = 28.9 bits (63), Expect = 5.2 Identities = 20/77 (25%), Positives = 29/77 (37%) Frame = +3 Query: 57 TICSWDRDTYPSXWXVLXXXXXXXXXXXXVVNCLGHGLMEQCLVPVVVHDPELDAGDGLE 236 TIC WD T P ++ V + H L+ + L V D +L D Sbjct: 200 TICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWH-LLHESLFGSVADDQKLMIWDTRS 258 Query: 237 QHLRGVSVGVDGHDADL 287 + S VD H A++ Sbjct: 259 NNTSKPSHAVDAHTAEV 275 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,292,226 Number of Sequences: 219361 Number of extensions: 593827 Number of successful extensions: 1480 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1480 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)