| Clone Name | rbah61d15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PAG1_BOVIN (Q29432) Pregnancy-associated glycoprotein 1 precurso... | 28 | 8.1 | 2 | CONS_ARATH (Q39057) Zinc finger protein CONSTANS | 28 | 8.1 |
|---|
>PAG1_BOVIN (Q29432) Pregnancy-associated glycoprotein 1 precursor (EC| 3.4.23.-) (PAG 1) (Pregnancy-specific protein B) (PSP-B) Length = 380 Score = 28.5 bits (62), Expect = 8.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 170 LPSSDNNALPTYLFILRAPIARVPGATYIHKIDR 271 +P S+ N LP+ +F + VPG YI K DR Sbjct: 301 VPCSEVNTLPSIVFTINGINYPVPGRAYILKDDR 334
>CONS_ARATH (Q39057) Zinc finger protein CONSTANS| Length = 373 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 313 RSASIKFDNSRAHQQKNMELLTFSCSRGSSGT 408 R +K + SR HQ N + F+ GSSGT Sbjct: 212 RVVPLKLEESRGHQCHNQQNFQFNIKYGSSGT 243 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,308,927 Number of Sequences: 219361 Number of extensions: 1285803 Number of successful extensions: 2902 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2902 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)