Clone Name | rbah61c24 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UVRC_WOLSU (Q7M8K0) UvrABC system protein C (Protein uvrC) (Exci... | 29 | 8.8 | 2 | PAC_BACME (Q60136) Penicillin G acylase precursor (EC 3.5.1.11) ... | 29 | 8.8 |
---|
>UVRC_WOLSU (Q7M8K0) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 602 Score = 29.3 bits (64), Expect = 8.8 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 443 LTSLKYSMMQIDCTHTKGGLCVDSVVIYPKGYRRE 339 L SL + D +H +G CV ++V+Y +G+ +E Sbjct: 388 LESLPRRIEAFDTSHLRGEACVGAMVVYEEGFCKE 422
>PAC_BACME (Q60136) Penicillin G acylase precursor (EC 3.5.1.11) (Penicillin G| amidase) (Penicillin G amidohydrolase) [Contains: Penicillin G acylase zymogen; Penicillin G acylase alpha subunit; Penicillin G acylase beta subunit] Length = 802 Score = 29.3 bits (64), Expect = 8.8 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -3 Query: 578 WDARPTRFQLSTSDEQQATSEYYLDGPGSWILYHVGDFVISNS 450 W F+ + S+ + + YY D G YHVG + + NS Sbjct: 428 WAKNLKEFENAASEYTMSLNWYYADKKGDIAYYHVGRYPVRNS 470 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,883,586 Number of Sequences: 219361 Number of extensions: 1558175 Number of successful extensions: 3914 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3911 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)