Clone Name | FLbaf97g07 |
---|---|
Clone Library Name | barley_pub |
>Q8S0J7:IM30_ORYSJ Probable membrane-associated 30 kDa protein, chloroplast precursor| - Oryza sativa subsp. japonica (Rice) Length = 317 Score = 29.6 bits (65), Expect = 3.3 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +3 Query: 6 DIERELNELREKANDY 53 +IE ELNELR+KAN+Y Sbjct: 302 EIENELNELRKKANEY 317
>O80796:IM30_ARATH Probable membrane-associated 30 kDa protein, chloroplast precursor| - Arabidopsis thaliana (Mouse-ear cress) Length = 330 Score = 29.3 bits (64), Expect = 4.4 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +3 Query: 6 DIERELNELREKANDY 53 +IE ELNELR KAND+ Sbjct: 315 EIENELNELRRKANDF 330
>P93339:GBB_NICPL Guanine nucleotide-binding protein subunit beta - Nicotiana| plumbaginifolia (Leadwort-leaved tobacco) Length = 377 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 96 LLSQRTPEKRIACRFVQ-CAFEPSMHVFFCG 185 L SQ+T ++ C +V CAF PS H CG Sbjct: 95 LTSQKTHAIKLPCAWVMTCAFSPSGHSVACG 125
>Q00968:EGF_PIG Pro-epidermal growth factor precursor - Sus scrofa (Pig)| Length = 1214 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 132 CRFVQCAFEPSMHVFFCGEGMKASM*GR 215 CR C EP HV C EG S GR Sbjct: 325 CRGSMCGQEPKSHVCTCAEGYTLSQDGR 352
>Q09797:YAA3_SCHPO Uncharacterized protein C22G7.03 - Schizosaccharomyces pombe| (Fission yeast) Length = 236 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -3 Query: 279 LEIYTEVMVNCTMSFTGKMQRIFLTWMPSYLHHKRKHALKVQTRI 145 + I ++ +N T ++ I+ TW+P++ KRK K + R+ Sbjct: 164 IPIIEDISINEDTQRTVSLETIYATWIPTFWESKRKSHEKDEGRL 208 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 67,780,383 Number of extensions: 1416851 Number of successful extensions: 2833 Number of sequences better than 10.0: 5 Number of HSP's gapped: 2833 Number of HSP's successfully gapped: 5 Length of query: 130 Length of database: 100,686,439 Length adjustment: 96 Effective length of query: 34 Effective length of database: 74,354,119 Effective search space: 2528040046 Effective search space used: 2528040046 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)