Clone Name | FLbaf98p03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Q6TWC4:LEU3_SORMA 3-isopropylmalate dehydrogenase - Sordaria mac... | 28 | 7.2 | 2 | A2AKY4:Z804A_MOUSE Zinc finger protein 804A - Mus musculus (Mouse) | 28 | 7.5 | 3 | P28795:PEX3_YEAST Peroxisomal biogenesis factor 3 - Saccharomyce... | 28 | 9.5 |
---|
>Q6TWC4:LEU3_SORMA 3-isopropylmalate dehydrogenase - Sordaria macrospora| Length = 368 Score = 28.5 bits (62), Expect = 7.2 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -2 Query: 170 CGPQLPIHALQKREQGQTKGNSPPKNKTNYRNHL 69 CGP++ + A++ + +T NSP K N +NHL Sbjct: 14 CGPEVVVEAIKVLKSIET--NSPSAGKFNLQNHL 45
>A2AKY4:Z804A_MOUSE Zinc finger protein 804A - Mus musculus (Mouse)| Length = 1200 Score = 28.5 bits (62), Expect = 7.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 147 CSSKTRAGTDERKLASEKQNKLQESSGHLITHH 49 C+ K A T+ERK+ S + N L SS + H+ Sbjct: 281 CTDKATAQTEERKITSNENNTLLTSSFCQLQHY 313
>P28795:PEX3_YEAST Peroxisomal biogenesis factor 3 - Saccharomyces cerevisiae (Baker's| yeast) Length = 441 Score = 28.1 bits (61), Expect = 9.5 Identities = 18/67 (26%), Positives = 35/67 (52%) Frame = -2 Query: 221 VWYSLLHKHSLMYNFTLCGPQLPIHALQKREQGQTKGNSPPKNKTNYRNHLDTSSLITPK 42 VW +L+++ L + + + + L + + +++ +SP K+K N L+ SLI K Sbjct: 81 VWRMVLNENDLNLDSIVTQLKDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLI--K 138 Query: 41 FVCYSYT 21 V +YT Sbjct: 139 LVTVTYT 145 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 40,387,404 Number of extensions: 714718 Number of successful extensions: 2234 Number of sequences better than 10.0: 3 Number of HSP's gapped: 2234 Number of HSP's successfully gapped: 3 Length of query: 88 Length of database: 100,686,439 Length adjustment: 58 Effective length of query: 30 Effective length of database: 84,777,329 Effective search space: 2543319870 Effective search space used: 2543319870 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)