| Clone Name | FLbaf95n19 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os01g15900:12001.t01441:unspliced-genomic expressed protein| Length = 3464 Score = 29.9 bits (59), Expect(2) = 0.092 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 / -3 Query: 39 SSIANACC*CSEEDSMSWNGGTILRLTACGRELHVLTPSRAAT 167 SSI CC +D NG + L++ +C + +PSR+A+ Sbjct: 1155 SSIHRTCCREICQDDPKDNGQSSLKIKSCRYSTLIYSPSRSAS 1027 Score = 27.6 bits (54), Expect(2) = 0.092 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 / -3 Query: 3 GSSLPWPCTCEGSSIANACC 62 G PW + EGS N+CC Sbjct: 2847 GERSPWNASPEGSHCLNSCC 2788
>LOC_Os01g09030:12001.t00781:unspliced-genomic cupin, RmlC-type, putative, expressed| Length = 4257 Score = 36.3 bits (73), Expect = 0.12 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -3 / +2 Query: 293 VHQINPDGWTGTTVCGVTFAAICSRPQTQLCVQVVSSPRRAIGGSS 156 V + PDG + C V A C+R C +SSPRR +G S Sbjct: 374 VKSLAPDGGSRKNRCSV*SEAACARLPCVRCYSCLSSPRRTLGRES 511
>LOC_Os02g01350:12002.t00035:unspliced-genomic expressed protein| Length = 4644 Score = 35.9 bits (72), Expect = 0.16 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 / -1 Query: 6 SSLPWPCTCEGSSIANACC*C 68 SS WPC C SS ++ CC C Sbjct: 414 SSTSWPCPCSSSSSSSCCCRC 352
>LOC_Os02g12939:12002.t005572:unspliced-genomic expressed protein| Length = 4659 Score = 33.6 bits (67), Expect = 0.80 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 / -2 Query: 95 WGHNTPTHCLWQRVTCTN 148 W T HC W+ +TCTN Sbjct: 3821 WNSTTTAHCNWEGITCTN 3768
>LOC_Os05g41110:12005.t03650:unspliced-genomic 60S ribosomal protein L30, putative, expressed| Length = 1916 Score = 32.7 bits (65), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 / -3 Query: 3 GSSLPWPCTCEGSSIANACC*C 68 G S CTC SS A ACC*C Sbjct: 306 GRSCSRACTCRSSSPAAACC*C 241
>LOC_Os02g49660:12002.t04550:unspliced-genomic expressed protein| Length = 1331 Score = 32.7 bits (65), Expect = 1.5 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 / +1 Query: 156 RAATNCSSWGRHDLDAQLSLRTRTDCSKCNTTDCGACPS 272 RA CSSW R + R+ S TT C PS Sbjct: 682 RAPARCSSWTRTTCSSTRPTRSGRAASPATTTSCSTAPS 798
>LOC_Os01g16890:12001.t01538:unspliced-genomic 60S ribosomal protein L30, putative, expressed| Length = 3300 Score = 32.7 bits (65), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 / -3 Query: 3 GSSLPWPCTCEGSSIANACC*C 68 G S CTC SS A ACC*C Sbjct: 337 GRSCSRACTCRSSSRAAACC*C 272
>LOC_Os06g09430:12006.t00822:unspliced-genomic hypothetical protein| Length = 246 Score = 32.2 bits (64), Expect = 2.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 / +3 Query: 165 TNCSSWGRHDLDAQLSLRTRTDCSKCNTTDCGAC 266 ++C WG H DA R + +C CG C Sbjct: 141 SDCVIWGIHQCDASQITRFQGECRNTEVQTCGFC 242
>LOC_Os01g72380:12001.t06526:unspliced-genomic expressed protein| Length = 2929 Score = 26.7 bits (52), Expect(2) = 2.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 / +3 Query: 19 GHAHVRDRQSQMRAADV 69 GH HVR R+ Q+R AD+ Sbjct: 582 GHPHVRLRRRQVRRADM 632 Score = 25.8 bits (50), Expect(2) = 2.1 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 / +1 Query: 74 GRLNELEWGHNTPTHCLWQRVTCTN 148 G L +LEW +N +W + T+ Sbjct: 1372 GALEKLEWDYNVRVKTIWDSIWYTH 1446
>LOC_Os12g41490:12012.t03825:unspliced-genomic receptor-like protein kinase homolog RK20-1, putative, expressed| Length = 2793 Score = 28.6 bits (56), Expect(2) = 2.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 / +1 Query: 39 SSIANACC*CSEEDSMSWNGGTILRLTAC 125 S+ A CC C+ S W T R T+C Sbjct: 1435 SASARRCCTCTRSGSSVWCTATSSRATSC 1521 Score = 23.5 bits (45), Expect(2) = 2.7 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 / +2 Query: 245 HHRLWCLSIHRD*SDERTGNKMQLPP 322 H+ C+SI + +E+ G LPP Sbjct: 2390 HNNSQCMSIFKTIYNEKAGLMASLPP 2467
>LOC_Os10g42880:12010.t03512:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7968 Score = 31.8 bits (63), Expect = 2.8 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 / +1 Query: 89 LEWGHNTPTHCLWQR 133 +E GHN P+HCLW R Sbjct: 1417 VELGHNHPSHCLW*R 1461
>LOC_Os04g27670:12004.t02470:unspliced-genomic terpene synthase 7, putative, expressed| Length = 4081 Score = 31.8 bits (63), Expect = 2.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 / +3 Query: 373 GRSEELRTLLNCRRMRERWQL 311 G S ELR CRR ERW++ Sbjct: 1158 GLSRELRLFATCRRTNERWEI 1220
>LOC_Os03g16760:12003.t01458:unspliced-genomic protein phosphatase 2C containing protein, expressed| Length = 3530 Score = 28.1 bits (55), Expect(2) = 3.4 Identities = 20/83 (24%), Positives = 32/83 (38%) Frame = -1 / -1 Query: 274 MDGQAPQSVVLHLLQSVRVLKLSCASKSCRPQEEQLVAARLGVSTCNSLPQAVSRSIVPP 95 + G A LH L+++ V++L A Q + LV V P + V Sbjct: 1598 LGGGAMLGSELHALEAIPVVRLELAHHLGLEQLQVLVGPEEDVLEVRLAPPRQHGAAVAD 1419 Query: 94 FQLIESSSLHQQHAFAIDDPSHV 26 + +LHQ H A D + + Sbjct: 1418 VHQVHVLALHQHHQHARPDQAQL 1350 Score = 24.0 bits (46), Expect(2) = 3.4 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 / -3 Query: 333 ECENGGNCILL 301 +C+ GG+CILL Sbjct: 2841 KCQTGGHCILL 2809
>LOC_Os04g58210:12004.t05284:unspliced-genomic N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, putative,| expressed Length = 3772 Score = 27.6 bits (54), Expect(2) = 3.6 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 / -3 Query: 186 RHDLDAQLSLRTRTDCSKCNTTDCGACPSIGINLM 290 R+DLD + L R SK T G IG+N M Sbjct: 1775 RNDLDGLILLGNRRQQSKMTTNIAGVNRGIGMNKM 1671 Score = 24.4 bits (47), Expect(2) = 3.6 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 / -1 Query: 332 SPAVEQRSKFL*SPGYSIH 388 S A+ S+FL*+P Y +H Sbjct: 1303 SSAISP*SQFL*NPSYKVH 1247
>LOC_Os08g23880:12008.t02159:unspliced-genomic no apical meristem protein| Length = 1344 Score = 31.3 bits (62), Expect = 3.9 Identities = 15/55 (27%), Positives = 21/55 (38%) Frame = -3 / +2 Query: 338 QANARTVATASCCLSVHQINPDGWTGTTVCGVTFAAICSRPQTQLCVQVVSSPRR 174 Q AR A + +P GW+ CG AA +RP ++P R Sbjct: 215 QPTARAGRRAPATAAAAGGSPSGWSARATCGSPAAAAAARPSCSRSTGSTTTPAR 379
>LOC_Os05g01020:12005.t00005:unspliced-genomic paired amphipathic helix repeat family protein, expressed| Length = 8425 Score = 31.3 bits (62), Expect = 3.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 / +3 Query: 93 NGGTILRLTACGRELHVLTPSRAATNCS 176 N G +L L C ELHV PS A+ CS Sbjct: 7743 NSGNLLALLDCHYELHV**PSHASLYCS 7826
>LOC_Os02g33970:12002.t03038:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 1767 Score = 31.3 bits (62), Expect = 3.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 / -2 Query: 225 TDCSKCNTTDCGACPSIGINLMNGQATRCSCH 320 T CS C TT C AC + + +G + S H Sbjct: 770 TACSTC*TTSCSACGCVDVGAFSGVS*ISSSH 675
>LOC_Os06g28140:12006.t02518:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3979 Score = 30.9 bits (61), Expect = 5.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 / -2 Query: 225 TDCSKCNTTDCGACPSIGINLMNG 296 T CS C TT C AC + + +G Sbjct: 2286 TTCSTC*TTSCSACRCVDVEAFSG 2215
>LOC_Os06g24450:12006.t02256:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 2576 Score = 30.9 bits (61), Expect = 5.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 / -2 Query: 225 TDCSKCNTTDCGACPSIGINLMNG 296 T CS C TT C AC + + +G Sbjct: 850 TTCSTC*TTSCSACGCVDVEAFSG 779
>LOC_Os05g24430:12005.t02100:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 5252 Score = 30.9 bits (61), Expect = 5.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 / -3 Query: 225 TDCSKCNTTDCGACPSIGINLMNG 296 T CS C TT C AC + + +G Sbjct: 3573 TTCSTC*TTSCSACGCVDVEAFSG 3502
>LOC_Os04g08580:12004.t00726:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3553 Score = 30.9 bits (61), Expect = 5.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 / -3 Query: 225 TDCSKCNTTDCGACPSIGINLMNG 296 T CS C TT C AC + + +G Sbjct: 2288 TTCSTC*TTSCSACGCVDVEAFSG 2217
>LOC_Os02g46690:12002.t04256:unspliced-genomic F-box domain containing protein, expressed| Length = 2270 Score = 30.9 bits (61), Expect = 5.3 Identities = 10/42 (23%), Positives = 24/42 (57%) Frame = +3 / +3 Query: 147 TPSRAATNCSSWGRHDLDAQLSLRTRTDCSKCNTTDCGACPS 272 TP+R ++ G +++ +++ R+ + +C+ C +CPS Sbjct: 225 TPARTPPPAAAAGTGEMEVEVATRSSSSPRRCSG*SCPSCPS 350
>LOC_Os01g25760:12001.t02290:unspliced-genomic powdery mildew resistance protein PM3F, putative, expressed| Length = 5187 Score = 30.9 bits (61), Expect = 5.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 / -2 Query: 237 KCNTTDCGACPSIGINLMNGQATR 308 KC T+ G+ + GI+L NGQ+T+ Sbjct: 2432 KCRTSRAGSFQNFGISLHNGQSTK 2361
>LOC_Os01g22720:12001.t02003:unspliced-genomic hypothetical protein| Length = 4332 Score = 30.9 bits (61), Expect = 5.3 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -3 / -2 Query: 338 QANARTVATASCCLSVHQINPDGWTGTTVCGVTFAAICSRPQTQLCVQVVSSPRR 174 + +A T A CCLS P C + C R + +L + V +SP R Sbjct: 3791 RCSAATTRAAVCCLSSSVALPHARDDER*CALAHVGPCQRGRCKLPLLVAASPGR 3627
>LOC_Os05g27860:12005.t02437:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3221 Score = 30.9 bits (61), Expect = 5.4 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = -1 / -1 Query: 340 CRRMRERWQLHLVACPFIRLIPMDGQAPQSVVLHLLQSVRVLKLSCASK 194 CRR+R RW+ C RL P + P + + + V ++L+ +SK Sbjct: 1328 CRRLRRRWRSRRRWCTRRRLSPREDDVPLAP*NNGVACVSSMRLTVSSK 1182
>LOC_Os05g07200:12005.t00608:unspliced-genomic hypothetical protein| Length = 4140 Score = 30.9 bits (61), Expect = 5.4 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 / -1 Query: 41 VNRKCVLLM*RGRLNELEWGHNTPTHCLWQRV 136 ++R CV L RGR N L G NT H L R+ Sbjct: 1560 IHRNCVNLTERGRENLLGLGKNTARHHLLNRL 1465
>LOC_Os01g23760:12001.t02102:unspliced-genomic SRF-type transcription factor family protein| Length = 1224 Score = 24.9 bits (48), Expect(2) = 5.4 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -1 / +2 Query: 199 SKSCRPQEEQLVAARLGVSTCNSLPQAVSRSIVP 98 S + P AAR G C S +A SRS P Sbjct: 134 SSARAPSSPAAAAARRGRRRCGSRRRASSRSTAP 235 Score = 23.1 bits (44), Expect(2) = 5.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 / +1 Query: 260 TTVCGVTFAAICSRP 216 +T+CGV A +C+ P Sbjct: 106 STLCGVRVAFVCAGP 150
>LOC_Os03g57310:12003.t04998:unspliced-genomic syntaxin 121, putative, expressed| Length = 1400 Score = 25.8 bits (50), Expect(2) = 6.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 / +1 Query: 147 TPSRAATNCSSW 182 +PSRAA CS+W Sbjct: 745 SPSRAAARCSAW 780 Score = 24.0 bits (46), Expect(2) = 6.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 / +2 Query: 4 GLLYRGHAHVRDRQSQMRA 60 GLL+R H H+R R+ A Sbjct: 521 GLLHRPHPHLRRRRPPQEA 577
>LOC_Os05g39350:12005.t03476:unspliced-genomic expressed protein| Length = 2893 Score = 27.6 bits (54), Expect(2) = 6.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 / -1 Query: 7 LLYRGHAHVRDRQSQMRAADVARKTQ*VGMGAQ 105 L +R H H RDR + A V R+ + V + AQ Sbjct: 2206 LRHRRHVHERDRDAPRGAGRVPRRAEHVPVRAQ 2108 Score = 23.1 bits (44), Expect(2) = 6.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 / -1 Query: 171 CSSWGRHDLDAQLSLRTRTDCSKC 242 C+ WGR + + +RT S+C Sbjct: 901 CAPWGRRSWTRRGTAPSRTPQSRC 830
>LOC_Os03g57340:12003.t05001:unspliced-genomic dnaJ protein, putative, expressed| Length = 2921 Score = 26.7 bits (52), Expect(2) = 6.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 / -3 Query: 15 PWPCTCEGSSIANACC*C 68 P PC SS A+ CC C Sbjct: 2676 PPPCMSSSSSYASCCCCC 2623 Score = 24.0 bits (46), Expect(2) = 6.9 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 / -3 Query: 113 THCLWQRVTCTNTESS 160 THC W R C +S Sbjct: 1581 THCTWSRAHCEKGRAS 1534
>LOC_Os11g39510:12011.t03493:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8094 Score = 30.4 bits (60), Expect = 7.3 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = -3 / -2 Query: 224 SRPQTQLCVQVVSSPRRAIGGSSTRC*YM*LSATSSESEYCAPIPTH*VF 75 S P T L + + R A+ + RC S SS S + AP P H F Sbjct: 386 SSPSTLLNSSGLKAERIALAACALRCIACSFSVVSSISSFGAPTPVHTTF 237
>LOC_Os08g35670:12008.t03307:unspliced-genomic expressed protein| Length = 5042 Score = 30.4 bits (60), Expect = 7.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 / -1 Query: 275 DGWTGTTVCGVTFAAICSR 219 DGW+GT +CG+T + R Sbjct: 4346 DGWSGTAICGLTDEEVIHR 4290
>LOC_Os05g23830:12005.t02040:unspliced-genomic endo-1,4-beta-xylanase, putative| Length = 1654 Score = 30.4 bits (60), Expect = 7.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 / +2 Query: 6 SSLPWPCTCEGSSIANAC 59 S LPWP +C G S AC Sbjct: 41 SQLPWPASCSGVSCRAAC 94
>LOC_Os04g42610:12004.t03809:unspliced-genomic expressed protein| Length = 6110 Score = 30.4 bits (60), Expect = 7.3 Identities = 16/56 (28%), Positives = 24/56 (42%) Frame = +3 / -1 Query: 6 SSLPWPCTCEGSSIANACC*CSEEDSMSWNGGTILRLTACGRELHVLTPSRAATNC 173 +SL PCT + ++A C C+ S S+ LR +LT + T C Sbjct: 3878 NSLSCPCTTDSFDASSAYCNCTNWRSFSFLANNCLRCLFSSSNSCILTR*PSETGC 3711
>LOC_Os03g39284:12003.t03366:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10798 Score = 30.4 bits (60), Expect = 7.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 / -2 Query: 87 SWNGGTILRLTACGRELHVLTPSRAATNCSS 179 S+ G+ +R ACGR +P R AT C S Sbjct: 7794 SYRSGSPVRPAACGRSDRPWSPVRPATQCRS 7702
>LOC_Os02g09660:12002.t00813:unspliced-genomic hypothetical protein| Length = 267 Score = 30.4 bits (60), Expect = 7.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 / +3 Query: 284 INPDGWTGTTVCGVTFAAICSRP 216 + P WT TT CG+T A+ S P Sbjct: 111 VGPCSWTRTTRCGLTPNAVASAP 179
>LOC_Os01g39670:12001.t03493:unspliced-genomic ribosomal RNA apurinic site specific lyase, putative, expressed| Length = 1986 Score = 30.4 bits (60), Expect = 7.3 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +3 / +2 Query: 147 TPSRAATNCSSWGRHDLDAQLSLRTRTDCSKCNTTDCGACPSIG 278 +P RA NC+ W RH A LS + C + C + G Sbjct: 398 SPPRAFGNCA*WARHGRRALLSPPLCSPAHPCGASSLVPCNATG 529
>LOC_Os01g28550:12001.t02549:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 2545 Score = 30.4 bits (60), Expect = 7.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 / -3 Query: 225 TDCSKCNTTDCGACPSIGINLMNG 296 T CS C TT C AC + + +G Sbjct: 851 TACSTC*TTSCSACGCVDVEAFSG 780
>LOC_Os03g54790:12003.t04744:unspliced-genomic ATP-binding cassette sub-family B member 10, mitochondrial precursor,| putative, expressed Length = 5486 Score = 30.4 bits (60), Expect = 7.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 / +2 Query: 403 RADYSMNTVSGRSEELRTLLNCRRMRERWQLHLV 302 RA S+N +SG L LN +R+ + W H+V Sbjct: 2681 RAQCSINPISGHCSYLWR*LNHQRLHDNWFSHIV 2782
>LOC_Os03g16740:12003.t01456:unspliced-genomic protein kinase APK1A, chloroplast precursor, putative, expressed| Length = 3970 Score = 30.4 bits (60), Expect = 7.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -2 / +3 Query: 312 CILLPVRSSD*SRWMDRHHSLWCYICCN 229 C+ LP++S+ *S + +HH L YIC + Sbjct: 2577 CVFLPLKSTH*S*Y*LQHHVL*IYICAH 2660
>LOC_Os02g12910:12002.t01088:unspliced-genomic receptor-like protein kinase 5 precursor, putative, expressed| Length = 3072 Score = 30.4 bits (60), Expect = 7.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 / +1 Query: 95 WGHNTPTHCLWQRVTCTN 148 W N+ HC W +TCT+ Sbjct: 160 WSSNSAAHCNWGGITCTD 213
>LOC_Os08g38520:12008.t03587:unspliced-genomic F-box domain containing protein| Length = 846 Score = 24.0 bits (46), Expect(2) = 7.4 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +3 / +1 Query: 96 GGTILRLTACGRELHVLTPSRAATNCSSWGRHD 194 GG +L G LHV P+R W ++ Sbjct: 325 GGFVLSNPVTGEALHVPLPTRIGAPWRRWEHNE 423 Score = 23.5 bits (45), Expect(2) = 7.4 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 / +2 Query: 261 ACPSIGINLMNGQATRCSC 317 +CPS G++TRC C Sbjct: 467 SCPSPSTTGGRGRSTRCRC 523
>LOC_Os02g36380:12002.t03275:unspliced-genomic cryptochrome 1 apoprotein, putative, expressed| Length = 3787 Score = 24.9 bits (48), Expect(2) = 8.8 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 / -2 Query: 160 ARLGVSTCNSLPQAVSRSIVPPFQLIESSSLHQQHA 53 +R ++ C ++P AVS + +S S HQ+ A Sbjct: 1485 SRSALNDCTAMPSAVSSAFTRWSLTSDSGSAHQKTA 1378 Score = 22.1 bits (42), Expect(2) = 8.8 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 / -3 Query: 41 RSLTCAWP 18 RS++CAWP Sbjct: 1379 RSVSCAWP 1356 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 194,133,878 Number of extensions: 3362823 Number of successful extensions: 15004 Number of sequences better than 10.0: 43 Length of query: 145 Length of database: 55,613,886 Length adjustment: 47 Effective length of query: 98 Effective length of database: 52,968,820 Effective search space: 5190944360 Effective search space used: 5190944360 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)