| Clone Name | FLbaf94k11 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g02240:12005.t00123:unspliced-genomic ATCHX20, putative, expressed| Length = 4446 Score = 37.3 bits (75), Expect(2) = 0.019 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +2 / +3 Query: 368 PQSSLKPPTASVRAREGRR*TRYLSASHPLPSVAHSRR 481 PQ PP + R R GRR R+L A+ P P H RR Sbjct: 3171 PQRRPLPPPSPRRRRPGRRRLRHLRAARPRPRPPHDRR 3284 Score = 24.4 bits (47), Expect(2) = 0.019 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 / +1 Query: 118 GRADSSNTPAPFPSKSPVMPP 180 GR PAP P SP PP Sbjct: 190 GRPAPLRLPAPHPPSSPHPPP 252
>LOC_Os05g47540:12005.t04190:unspliced-genomic phosphoethanolamine N-methyltransferase, putative, expressed| Length = 4297 Score = 33.6 bits (67), Expect(2) = 0.033 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = -3 / +1 Query: 386 ASTKIAVARGLHSLHLAYQRDHGSGLHPLEGKANARDLEVERGLNH 249 A T+ R LHS L+ R G PLE + R L +RGL H Sbjct: 19 ARTRPVPLRLLHSTPLSVARAVGVAFFPLESRGGIRRLMQQRGLAH 156 Score = 27.2 bits (53), Expect(2) = 0.033 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 / +2 Query: 57 HRRLNWGFGKRSW 19 +R L WG GKRSW Sbjct: 1544 NRTLYWGTGKRSW 1582
>LOC_Os10g38800:12010.t03120:unspliced-genomic ATP binding protein, putative, expressed| Length = 2671 Score = 37.7 bits (76), Expect = 0.072 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +1 / -1 Query: 241 SPPWFKPRSTSRSRALALPSSGCKPLP*SRWYARCR 348 SP + S R RA A PSS C +P* W RCR Sbjct: 1435 SPRCRRRGSPPRRRAAAAPSSSCSCMP*CSWQIRCR 1328
>LOC_Os02g48184:12002.t005557:unspliced-genomic expressed protein| Length = 1304 Score = 30.4 bits (60), Expect(2) = 0.094 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +1 / -2 Query: 223 PWSTEASPPWFKPRSTSRSRALALPSSGCKPLP*SRWYARCREWSP 360 P + ASP P S+SR + +LPS P R R EW+P Sbjct: 259 PPPSAASPTTGSPSSSSRPPSSSLPSRTSPPAGRWRPVERIDEWAP 122 Score = 24.4 bits (47), Expect(2) = 0.094 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 / -2 Query: 124 ADSSNTPAPFPSKSPVMPPS 183 + SS +P+P PS PPS Sbjct: 337 SSSSTSPSPTPSSPTSTPPS 278
>LOC_Os07g39370:12007.t03598:unspliced-genomic hypothetical protein| Length = 974 Score = 35.0 bits (70), Expect(2) = 0.13 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = +2 / +2 Query: 224 PGPPKLLRHGLSPARPRDLGH*PYPPVDANRFRDHAGMPGAENGAP*LP 370 PGPP++ H P RP GH PP + H G P P Sbjct: 503 PGPPRVRAHRGGPPRPARRGHLRRPPAEPTHPAAHRPPAGDHGSGPDQP 649 Score = 21.7 bits (41), Expect(2) = 0.13 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +1 / +1 Query: 118 GRADSSNTPAPFPSKSPVMPPSIAN 192 G ++++P+P + S PP+ A+ Sbjct: 409 GSCSATSSPSPIAAAS*TSPPAAAS 483
>LOC_Os06g17260:12006.t01598:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative, expressed| Length = 1428 Score = 25.4 bits (49), Expect(3) = 0.13 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 / -3 Query: 124 ADSSNTPAPFPSKSPVMPP 180 A + +PAP P+ +P PP Sbjct: 1045 APTRGSPAPLPTPTPTPPP 989 Score = 22.6 bits (43), Expect(3) = 0.13 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / -3 Query: 332 GMPGAENGAP*LPQSSLKPPT 394 G P GAP +SS PPT Sbjct: 904 GTPRVAAGAPSCSRSSRTPPT 842 Score = 22.1 bits (42), Expect(3) = 0.13 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 / -3 Query: 217 RIPWSTEASPPWFKPRSTS 273 R P + + PW +PR T+ Sbjct: 988 RAPRTPPGASPWTRPRRTA 932
>LOC_Os03g53550:12003.t04674:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 2049 Score = 36.8 bits (74), Expect = 0.14 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 / +1 Query: 61 AVSAYGETHCHHGQAKFEIGRADSSNTPAPFPS 159 AV A G HCH GQ+ + AD+ + P P P+ Sbjct: 898 AVRADGAVHCHPGQSPWPRDTADAGSAPGPAPA 996
>LOC_Os05g01350:12005.t00037:unspliced-genomic AFH1, putative, expressed| Length = 4124 Score = 28.6 bits (56), Expect(3) = 0.14 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +1 / +3 Query: 85 HCHHGQAKFEIGRADSSNTPAPFPSKSPVMPP 180 HCHH A +S+ P P+ + PP Sbjct: 501 HCHHAHPSTSAPCAPASSPPPSHPATATASPP 596 Score = 25.8 bits (50), Expect(3) = 0.14 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 / +2 Query: 383 KPPTASVRAREGRR*TRYLSASHPLPSVAH 472 +PP SVR R+ +R AS LP+ +H Sbjct: 1190 RPPPISVRDRQSSALSRRSHASAHLPASSH 1279 Score = 23.1 bits (44), Expect(3) = 0.14 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 / +3 Query: 224 PGPPKLLRHGLSPARPRDLGH*PYPP 301 PGPP LL L P R P PP Sbjct: 900 PGPPPLLPFPLPPPPLRPPLPPPLPP 977
>LOC_Os08g35620:12008.t03302:unspliced-genomic RSH2, putative, expressed| Length = 4003 Score = 28.1 bits (55), Expect(3) = 0.17 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 / +2 Query: 115 IGRADSSNTPAPFPSKSPVMPPS 183 +GR+D+ P PFPS S P S Sbjct: 3023 LGRSDAIRPPCPFPSHSEDCPYS 3091 Score = 25.4 bits (49), Expect(3) = 0.17 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 / +2 Query: 346 REWSPLATAIFVEATHCLCSCTRG 417 REW P+ + A+H +C RG Sbjct: 3314 REWGPIVQDAALTASH*KRNCARG 3385 Score = 23.5 bits (45), Expect(3) = 0.17 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 / +2 Query: 35 NPQLSRLWSPCPPTVK 82 NPQ +R SP PP ++ Sbjct: 62 NPQETRAKSPLPPRIR 109
>LOC_Os01g08660:12001.t00744:unspliced-genomic aquaporin SIP1.1, putative, expressed| Length = 2190 Score = 29.0 bits (57), Expect(3) = 0.19 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 / +1 Query: 226 WSTEASPPWFKPRSTSRSRALALPSSGCKPLP 321 W + +S PW S+SR + GC P P Sbjct: 634 WCSPSSSPWPCSGSSSRGPVIPSSRPGCSPSP 729 Score = 23.5 bits (45), Expect(3) = 0.19 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 / +1 Query: 125 PIHQIPLLHFPPRVPLCR 178 P+ PLL PPR PL R Sbjct: 376 PLLPPPLLPLPPRPPLPR 429 Score = 22.6 bits (43), Expect(3) = 0.19 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 / +3 Query: 3 PCSVSTKTASQTPN 44 PCS S T+S TP+ Sbjct: 285 PCSSSPSTSSATPS 326
>LOC_Os11g38630:12011.t03406:unspliced-genomic conserved hypothetical protein| Length = 7619 Score = 35.9 bits (72), Expect = 0.26 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +1 / -1 Query: 229 STEASPPWFKPRSTSRSRALALPSSGC 309 ST A PP F P ST+R+ A A P S C Sbjct: 146 STSAEPPCFSPSSTARAIAAAKPPSWC 66
>LOC_Os02g45530:12002.t04140:unspliced-genomic protein HOTHEAD precursor, putative, expressed| Length = 2433 Score = 28.6 bits (56), Expect(2) = 0.30 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 / -1 Query: 223 PWSTEASPPWFKPRSTSRSRA 285 P T + PPW R SRSRA Sbjct: 588 PTGTRSPPPWGPTRGPSRSRA 526 Score = 24.4 bits (47), Expect(2) = 0.30 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 / -2 Query: 386 PPTASVRAREGRR*TRYLSASHPLPSVAHS 475 P A RARE +A HP P V H+ Sbjct: 542 PHVAGPRAREEAGVDAAAAAQHPRPRVDHA 453
>LOC_Os05g04990:12005.t00391:unspliced-genomic S-adenosylmethionine decarboxylase proenzyme 2, putative, expressed| Length = 1080 Score = 29.9 bits (59), Expect(2) = 0.32 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 / +2 Query: 119 AVPIHQIPLLHFPPRVPLCRLPSPIASRNKS*AEFPGPP 235 A P P PPR P PSP ++R S + P PP Sbjct: 809 ATPASSAPPTTPPPRSPPSAAPSPRSARPPSRSPSPTPP 925 Score = 23.1 bits (44), Expect(2) = 0.32 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 / +3 Query: 215 AEFPGPPKLLRHGLSPARPRDL 280 A +PG P R GL R RDL Sbjct: 969 AAWPGVPLPRRRGLPRRRHRDL 1034
>LOC_Os12g44130:12012.t04079:unspliced-genomic expressed protein| Length = 3158 Score = 29.9 bits (59), Expect(2) = 0.40 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 / +3 Query: 211 MSRIPWSTEASPPWFKPRSTSRSRALALPSSGCKP 315 +S P S +PP P T R R A PS+ C+P Sbjct: 459 LSSTPTSPAPAPPPPPPPPTHRPRPSAPPSTTCRP 563 Score = 22.6 bits (43), Expect(2) = 0.40 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = +2 / +3 Query: 338 PGAENGAP*LPQSSLKPPTASVRAREGRR*TRYLSASHPLPSVAHSR 478 PG+ G+P P + A+ RA + L++ P P + +R Sbjct: 630 PGSRPGSPPSPTDGVPLARATTRAAPSPTWSTRLTSMCPPPGMPRTR 770
>LOC_Os04g01690:12004.t00067:unspliced-genomic arginine decarboxylase, putative, expressed| Length = 3546 Score = 33.1 bits (66), Expect(2) = 0.41 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 / +3 Query: 262 RSTSRSRALALPSSGCKPLP*SRWYARCREW 354 R TS R + SSGC P +RW A R W Sbjct: 2130 RDTSAPRPASTASSGCSPTRSTRWPAS*RRW 2222 Score = 23.5 bits (45), Expect(2) = 0.41 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 / +3 Query: 223 PWSTEASPPWFKPRSTSRS 279 P STE SPP P + +RS Sbjct: 1623 PSSTELSPPPSPPTTATRS 1679
>LOC_Os11g29340:12011.t02539:unspliced-genomic DNA binding protein, putative, expressed| Length = 5813 Score = 35.0 bits (70), Expect = 0.49 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 / +2 Query: 32 PNPQLSRLWSPCPPTVKLTATTVRLNLR*AVP 127 P + R W PP+++L ATTV LNL A P Sbjct: 4046 PKKKKERKWPELPPSIELFATTVHLNL*SAQP 4141
>LOC_Os07g37620:12007.t03431:unspliced-genomic fiber expressed protein, putative, expressed| Length = 1680 Score = 35.0 bits (70), Expect = 0.49 Identities = 25/86 (29%), Positives = 33/86 (38%) Frame = +2 / -3 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPRDLGH*PYPPVDANRFRDHAG 334 PPR + S SR+ S P PP +P+ PR+ P PP A R A Sbjct: 622 PPRRCSSAVASMPTSRS*SSPPLPPPPAPSSPPPAPSPPREWAREPSPPAPAQRAPPSAS 443 Query: 335 MPGAENGAP*LPQSSLKPPTASVRAR 412 P A P + +P + R R Sbjct: 442 SPPARAPPPPGLEPEPEPAAPTTRRR 365
>LOC_Os03g21230:12003.t01878:unspliced-genomic protein kinase, putative, expressed| Length = 5324 Score = 24.4 bits (47), Expect(4) = 0.59 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +1 / +1 Query: 226 WSTEASPPWFKPRSTSRSR 282 W P W PR+ S SR Sbjct: 3253 WRAGCGPSWTSPRAPSSSR 3309 Score = 24.4 bits (47), Expect(4) = 0.59 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 / +1 Query: 262 RSTSRSRALALPSSGCKPLP 321 R +SR R+LAL +S +P P Sbjct: 3424 RPSSRPRSLALTTSSPRPTP 3483 Score = 22.6 bits (43), Expect(4) = 0.59 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 / +3 Query: 380 LKPPTASVRAREGRR 424 L+P ASVR REG R Sbjct: 4344 LRPLQASVRHREGPR 4388 Score = 22.1 bits (42), Expect(4) = 0.59 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 / +1 Query: 144 CSISLQESRYAAFHRQLLP 200 CSI+L S Y + LLP Sbjct: 958 CSITLHVSNYKVYVYPLLP 1014
>LOC_Os03g19770:12003.t01741:unspliced-genomic PE-PGRS FAMILY PROTEIN, putative| Length = 621 Score = 28.1 bits (55), Expect(2) = 0.60 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 / -1 Query: 223 PWSTEASPPWFKPRSTSRSRALALPSSGCKPL 318 P + ASPP R RS A + P++ C P+ Sbjct: 444 PRAAPASPPRSSTRHHHRSHASSAPAAACIPV 349 Score = 24.0 bits (46), Expect(2) = 0.60 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 / -2 Query: 131 HQIPLLHFPPRVPLCRLP 184 HQ P PP P CR P Sbjct: 503 HQTPASATPPNWPPCRRP 450
>LOC_Os01g34680:12001.t03025:unspliced-genomic conserved hypothetical protein| Length = 5782 Score = 28.6 bits (56), Expect(2) = 0.63 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / -3 Query: 38 PQLSRLWSPCPPTVKLTATT 97 PQLS + CPPT KL +T Sbjct: 1454 PQLSPEYDSCPPTTKLGIST 1395 Score = 28.1 bits (55), Expect(2) = 0.63 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = +2 / -3 Query: 140 PLLHFPPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPRDLG 283 PLL P VP + +R + + P PPK G R R+ G Sbjct: 191 PLLPLPTAVPTATATATAPARCRRRSPPPSPPKRNAEGKREIREREKG 48
>LOC_Os05g43180:12005.t03810:unspliced-genomic hypothetical protein| Length = 793 Score = 29.5 bits (58), Expect(2) = 0.63 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 / -2 Query: 97 GQAKFEIGRADSSNTPAPFPSKSPVMPPS 183 G F+ SS TP+PFPS SP PS Sbjct: 756 GTIPFQSLFLSSSLTPSPFPSSSPPSFPS 670 Score = 24.4 bits (47), Expect(2) = 0.63 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 / -1 Query: 304 GCKPLP*SRWYARCREWSPLATAIFVEAT 390 G P P + W A CR + A+A+ V A+ Sbjct: 88 GPPPPPSTAWVAACRGGTTAASALPVNAS 2
>LOC_Os09g03670:12009.t00264:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 687 Score = 34.5 bits (69), Expect = 0.67 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 / +2 Query: 217 RIPWSTEASPPWFKPRSTSRSRALALPSSGCKPLP 321 R PW + P+F+PR++ R AL ++ C+ P Sbjct: 512 RSPWHKTPATPFFRPRASCRGST*ALSANSCQRTP 616
>LOC_Os06g42220:12006.t03913:unspliced-genomic too many mouths protein precursor, putative, expressed| Length = 1472 Score = 34.5 bits (69), Expect = 0.67 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 / +2 Query: 238 ASPPWFKPRSTSRSRALALPSSGCKPLP*SRWYARC 345 ASPPW P SR+R+ S C P W A C Sbjct: 950 ASPPWASPTPASRARSRRRWGSRCATSPTWGWTATC 1057
>LOC_Os05g34120:12005.t03007:unspliced-genomic hypothetical protein| Length = 2309 Score = 34.5 bits (69), Expect = 0.67 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 / -3 Query: 64 VSAYGETHCHHGQAKFEIGRADSSNTPAPFPSKSPVMPP 180 +S+Y HC+ K + A +TPAP PS P PP Sbjct: 423 LSSYAIQHCNDDIVKSLLELAAWPSTPAPTPSSPPTHPP 307
>LOC_Os05g04410:12005.t00337:unspliced-genomic peroxidase 2 precursor, putative, expressed| Length = 2422 Score = 34.5 bits (69), Expect = 0.67 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 / +2 Query: 121 RADSSNTPAPFPSKSPVMPPS 183 R SS++PAP PS SP PPS Sbjct: 1517 RGSSSSSPAPTPSASPTSPPS 1579
>LOC_Os01g73170:12001.t06599:unspliced-genomic peroxidase 12 precursor, putative, expressed| Length = 3117 Score = 34.5 bits (69), Expect = 0.67 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +1 / +1 Query: 130 SSNTPAPFPSKSPVMPPSIANC 195 SS +PAP PS SP PPS C Sbjct: 2380 SSRSPAPTPSASPTAPPSPGGC 2445
>LOC_Os01g18880:12001.t01678:unspliced-genomic expressed protein| Length = 4604 Score = 28.1 bits (55), Expect(2) = 0.71 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 / +2 Query: 118 GRADSSNTPAPFPSKSPVMPPSIA 189 G SS +P P PS SP +PP A Sbjct: 407 GSPSSS*SPPPAPSPSPRLPPPSA 478 Score = 23.5 bits (45), Expect(2) = 0.71 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / +3 Query: 26 RFPNPQLSRLWSPCPP 73 R P+PQ RL P PP Sbjct: 300 RLPSPQPRRLPFPAPP 347
>LOC_Os03g37100:12003.t03171:unspliced-genomic DTW domain containing protein, expressed| Length = 1745 Score = 30.4 bits (60), Expect(2) = 0.72 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 / -2 Query: 97 RGGSEFHRRRTRRPQAAQLGVW 32 R G +FHRRR RR +A+ G W Sbjct: 358 RDGHDFHRRRRRRRRAS*GGSW 293 Score = 24.4 bits (47), Expect(2) = 0.72 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 / -2 Query: 398 RQWVASTKIAVARGLHSLHLAYQRDHGSGLHPLE 297 R +V+++ ++ L SL + DH LHPL+ Sbjct: 1531 RVFVSNSHPCISVDLQSLTRKHPADHPVPLHPLQ 1430
>LOC_Os02g02150:12002.t00115:unspliced-genomic ATP-dependent helicase yprA, putative, expressed| Length = 3195 Score = 26.7 bits (52), Expect(2) = 0.72 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 / +3 Query: 244 PPWFKPRSTSRSRA 285 P WF P STS SRA Sbjct: 306 PRWFPPTSTSSSRA 347 Score = 24.9 bits (48), Expect(2) = 0.72 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 / +3 Query: 139 TPAPFPSKSPVMPPS 183 T AP PS+SP PPS Sbjct: 225 TGAPPPSRSPPPPPS 269
>LOC_Os10g22980:12010.t01776:unspliced-genomic protein binding protein, putative, expressed| Length = 5112 Score = 32.2 bits (64), Expect(2) = 0.76 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 / +2 Query: 157 SKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKPRSTSRSRALA 291 S S PP+ A MSR +T SPPW +P+ + + +A Sbjct: 1817 SSSTRRPPNAATERSRRAMSRSSSTTRLSPPWRRPKEAAAATIMA 1951 Score = 24.0 bits (46), Expect(2) = 0.76 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / +2 Query: 308 ANRFRDHAGMPGAENGAP*LPQ 373 A + R H G PGA+ A PQ Sbjct: 3194 AEQDRQHRGAPGADQAARSQPQ 3259
>LOC_Os01g19230:12001.t01713:unspliced-genomic conserved hypothetical protein| Length = 604 Score = 26.7 bits (52), Expect(2) = 0.80 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 / -3 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPP 235 PP P CRLP P A+ + + PP Sbjct: 401 PPPPPHCRLPDPAAAASTAWLGASPPP 321 Score = 24.9 bits (48), Expect(2) = 0.80 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 / -2 Query: 327 TLVCQVQRMEPPSYR 371 T CQ++R+ PP +R Sbjct: 297 TAACQIRRLPPPPHR 253
>LOC_Os05g48840:12005.t04318:unspliced-genomic expressed protein| Length = 935 Score = 34.1 bits (68), Expect = 0.92 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +1 / +3 Query: 226 WSTEASPPWFKPRSTSRSRALALPSSGCKPLP*SRWYARCR 348 W T +SP W P S +R S+ C P R RCR Sbjct: 540 WCTPSSP*WCSPPSRCSTRTWCRASTRCHPRARGRCSRRCR 662
>LOC_Os04g39940:12004.t03559:unspliced-genomic conserved hypothetical protein| Length = 2453 Score = 34.1 bits (68), Expect = 0.92 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +2 / +1 Query: 440 SASHPLPSVAHSRR*VFNSKRRMPWSTFSFP 532 +A+HP P+V+H+RR V +RRM + S P Sbjct: 811 AAAHPAPAVSHARRGVLLLERRMYSTAVSLP 903
>LOC_Os03g35710:12003.t03054:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4473 Score = 34.1 bits (68), Expect = 0.92 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 / -3 Query: 158 PRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARP 271 P P CR P+ R +S A P PP R +PA P Sbjct: 1291 PPFPCCRAVVPVPPRRRSRAAVPAPPFPCRRVAAPALP 1178
>LOC_Os01g13160:12001.t01179:unspliced-genomic expressed protein| Length = 5554 Score = 34.1 bits (68), Expect = 0.92 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 / +1 Query: 152 FPPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPRDLG 283 F P CR P+P S + PGPP L P RPR LG Sbjct: 112 FHPPRRTCRSPAPPTSPPLPSSPRPGPPPPLSDPPLPRRPRQLG 243
>LOC_Os09g28750:12009.t02553:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1176 Score = 27.2 bits (53), Expect(2) = 1.0 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / +2 Query: 124 ADSSNTPAPFPSKSPVMPP 180 A SS T P PS+ P MPP Sbjct: 110 AASSATSVPTPSRPPQMPP 166 Score = 24.0 bits (46), Expect(2) = 1.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 / +3 Query: 245 RHGLSPARPRDLGH*PYPPVDANRFRDHAGMPGAENGAP 361 RH RPR L PP+ R R G G E AP Sbjct: 162 RHRRRLQRPRHLPRRLRPPLPPARRRRERGR*GKEAPAP 278
>LOC_Os04g27890:12004.t02492:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5937 Score = 32.7 bits (65), Expect(2) = 1.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 / +2 Query: 386 PPTASVRAREGRR*TRYLSASHPLPSVAHSRR 481 PP V+AR RR T++L HP + H RR Sbjct: 2228 PPCRGVQARGWRRETQHLRPGHPKAADGHMRR 2323 Score = 23.1 bits (44), Expect(2) = 1.2 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 / +1 Query: 244 PPWFKPRSTSR 276 PPWF+P T + Sbjct: 700 PPWFRPTITEK 732
>LOC_Os01g49760:12001.t04414:unspliced-genomic expressed protein| Length = 5597 Score = 25.8 bits (50), Expect(2) = 1.3 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 / +1 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPP 235 PPR P R P P+ + A P PP Sbjct: 166 PPRAPPPRPPLPLRLPRRRRASGPSPP 246 Score = 24.9 bits (48), Expect(2) = 1.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 / +3 Query: 244 PPWFKPRSTSRSRALALPSSGCK 312 PP +P S S SRALA ++ C+ Sbjct: 267 PPPPQPSSPSPSRALASAAAACE 335
>LOC_Os10g34270:12010.t02725:unspliced-genomic expressed protein| Length = 1005 Score = 33.6 bits (67), Expect = 1.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 / +2 Query: 226 WSTEASPPWFKPRSTSRSRALA 291 W+T A+PPW +PRS+ S + A Sbjct: 266 WATTAAPPWRRPRSSPSSASAA 331
>LOC_Os04g36640:12004.t03285:unspliced-genomic dehydration-responsive element-binding protein 1D, putative| Length = 555 Score = 33.6 bits (67), Expect = 1.3 Identities = 20/61 (32%), Positives = 25/61 (40%) Frame = +2 / -3 Query: 224 PGPPKLLRHGLSPARPRDLGH*PYPPVDANRFRDHAGMPGAENGAP*LPQSSLKPPTASV 403 PG R A PR P PP ++R R + P A + P P SS PP + Sbjct: 211 PGS*AARRGRAGGAPPRRAPPPPSPPTRSSRARCGSWSPAAGSPTPTSPTSSSSPPCTGI 32 Query: 404 R 406 R Sbjct: 31 R 29
>LOC_Os02g40140:12002.t03650:unspliced-genomic ligA, putative| Length = 2365 Score = 29.5 bits (58), Expect(2) = 1.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 / +2 Query: 200 WKQLAMEGGITGLLEGNGAGVFDESARPI 114 W EGG+TG+++G G SA P+ Sbjct: 743 WSFEGKEGGLTGVVKGRGRRAGSASAAPL 829 Score = 24.9 bits (48), Expect(2) = 1.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 / +1 Query: 63 GDHRRLNWGFGKRSWCSL 10 GD R W F RSW +L Sbjct: 1594 GDEREQQWRFELRSWHNL 1647
>LOC_Os04g01610:12004.t00059:unspliced-genomic expressed protein| Length = 1998 Score = 32.2 bits (64), Expect(2) = 1.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +1 / +2 Query: 259 PRSTSRSRALALPSSGCKPLP*SRWYARCREWSPLATAIFVEATHCLCSCT 411 P +++ A + S + P R R R W P T+ A HC CS T Sbjct: 404 PSASASRSATSPAPSRTRRAPPRRRSGRRRRWRPRGTSSTTRACHCRCSRT 556 Score = 21.7 bits (41), Expect(2) = 1.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 / +2 Query: 124 ADSSNTPAPFPSKSPVMPP 180 A SS+ PAP S + +PP Sbjct: 14 ATSSSPPAPAASAARPIPP 70
>LOC_Os06g12120:12006.t01089:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor, putative, expressed Length = 4511 Score = 27.6 bits (54), Expect(2) = 1.7 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +2 / +1 Query: 140 PLLHFPPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPAR 268 P L PPR L SP R + PP+ RH LS R Sbjct: 205 PTLFTPPRPRPRSLRSPPRPRRLALTTTSPPPRPTRHSLSQGR 333 Score = 27.2 bits (53), Expect(2) = 1.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 / +1 Query: 289 ALPSSGCKPLP*SRWYARC 345 ALP S P+ *+RW ARC Sbjct: 511 ALPRSRPPPVR*NRWLARC 567
>LOC_Os11g42310:12011.t03762:unspliced-genomic F-box domain containing protein| Length = 1776 Score = 33.1 bits (66), Expect = 1.7 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = +1 / +2 Query: 139 TPAPFPSKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKPRSTSRSRALALPSSGC 309 T P+P +P P S A + + P +SPP PRS+ + A S C Sbjct: 173 TRCPWPRPTPTTPRSAATSARRTAAASTPSRRRSSPPSSPPRSSRATAASTAAPSRC 343
>LOC_Os07g11560:12007.t01029:unspliced-genomic hypothetical protein| Length = 2079 Score = 33.1 bits (66), Expect = 1.7 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +2 / -3 Query: 119 AVPIHQIPLLHFPPRVPLCRLPSPIASRNKS*AEFPGPPK 238 A P IP PRVP CR PSP R + PP+ Sbjct: 145 APPPTPIPTRRRLPRVPACRRPSPTRRRPRPSPPVAAPPR 26
>LOC_Os04g48070:12004.t04328:unspliced-genomic homeobox protein OCL1, putative, expressed| Length = 6341 Score = 33.1 bits (66), Expect = 1.7 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +1 / +3 Query: 250 WFKPRSTSRSRALALPSSGCKPLP*SRWYAR 342 W P +SRS ALA SS + SRWYAR Sbjct: 123 WSPPACSSRSPALARASSRHRRRSPSRWYAR 215
>LOC_Os07g44780:12007.t04118:unspliced-genomic esterase precursor, putative, expressed| Length = 2558 Score = 26.3 bits (51), Expect(2) = 1.8 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +2 / +1 Query: 242 LRHGLSPARPRDLGH*PYPPVDANRFRDHAGMPGAENGAP*LPQSSLKPP 391 LR G PAR R P P R R G+P P P PP Sbjct: 1795 LRPGPLPARLRPAPPLPLPGRRRRRPRPRHGLPPGAQRRPRRPPQRAPPP 1944 Score = 24.0 bits (46), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / +3 Query: 121 RADSSNTPAPFPSKSPVMPP 180 RA S+ +PAP S S PP Sbjct: 1731 RASSATSPAPSRSSSGSAPP 1790
>LOC_Os04g47000:12004.t04227:unspliced-genomic hypothetical protein| Length = 1815 Score = 31.3 bits (62), Expect(2) = 1.8 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +2 / -3 Query: 173 CRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPRDLGH*PYPPVDA 310 C P+P+A S P PP L L+ P P PVDA Sbjct: 958 CMPPAPVAPTTSSLRFVPPPPPALASSLAAVVPTSCVPPPLSPVDA 821 Score = 22.1 bits (42), Expect(2) = 1.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 / -3 Query: 121 RADSSNTPAPFPSKSPVMPPSI 186 RA P+P PS P PP + Sbjct: 1735 RAPPPLDPSPSPSPPPQPPPPL 1670
>LOC_Os05g18950:12005.t01662:unspliced-genomic methyltransferase small domain, putative, expressed| Length = 1732 Score = 25.4 bits (49), Expect(2) = 1.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 / +2 Query: 130 SSNTPAPFPSKSPVMPP 180 SS+ PA PS++P PP Sbjct: 209 SSSPPARSPSRTPTRPP 259 Score = 24.9 bits (48), Expect(2) = 1.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 / +3 Query: 227 GPPKLLRHGLSPARPRDLGH*PYPP 301 GPP L P RP H P PP Sbjct: 330 GPPPDLLRHARPRRPPQPPHLPLPP 404
>LOC_Os05g18604:12005.t004711:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass, expressed| Length = 33185 Score = 26.3 bits (51), Expect(2) = 2.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / -3 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLL 244 PPR LP+P SR+ S A G P LL Sbjct: 21390 PPRGAPPPLPAPATSRSASSARTLGEPLLL 21301 Score = 23.5 bits (45), Expect(2) = 2.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 / -2 Query: 223 PWSTEASPPWFKPRSTSRSRALALPSSGCKP 315 P + A PP P R A PSSGC P Sbjct: 21328 PHAR*APPPAPLPFRVHRHCP*APPSSGCSP 21236
>LOC_Os01g41180:12001.t03638:unspliced-genomic hypothetical protein| Length = 423 Score = 25.4 bits (49), Expect(2) = 2.0 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 329 AGMPGAENGAP*LPQSSLKPPTASVRAR 412 AG A + +P P +S P TAS RAR Sbjct: 215 AGAAPAPSPSPSPPAASPAPATASTRAR 298 Score = 24.9 bits (48), Expect(2) = 2.0 Identities = 11/43 (25%), Positives = 16/43 (37%) Frame = +1 / +1 Query: 115 IGRADSSNTPAPFPSKSPVMPPSIANCFQE*IMSRIPWSTEAS 243 + A A S S +MPP CF + + W + S Sbjct: 79 VAAAGGDELAAAVGSSSSIMPPCFHACFDQCVQREEYWFCQFS 207
>LOC_Os01g29409:12001.t02629:unspliced-genomic SAM binding motif, putative, expressed| Length = 13973 Score = 26.3 bits (51), Expect(2) = 2.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 / +2 Query: 85 HCHHGQAKFEIGRADSSNTPAPFPSKSPVMPPSIAN 192 H HH Q + + SS+T +P+P P PP+ N Sbjct: 212 HHHHHQ*LHLLLASASSST*SPWPLAPPRPPPARRN 319 Score = 23.5 bits (45), Expect(2) = 2.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 / +2 Query: 238 ASPPWFKPRSTSRSR 282 ASPPW P+ SR++ Sbjct: 398 ASPPWPPPQLASRAQ 442
>LOC_Os08g35510:12008.t03291:unspliced-genomic flavonoid 3-monooxygenase, putative| Length = 1563 Score = 29.0 bits (57), Expect(2) = 2.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 / -3 Query: 214 SRIPWSTEASPPWFKPRSTSRSRALALPSSGCKP 315 ++ P A PP P +++R+RA PSS P Sbjct: 1489 AQTPRPCSAPPPSSPPATSTRTRAAGWPSSAASP 1388 Score = 24.0 bits (46), Expect(2) = 2.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 / -3 Query: 368 PQSSLKPPTASVRAREGRR* 427 P PPT S R R GRR* Sbjct: 733 PAGPSSPPTGSSRRR*GRR* 674
>LOC_Os07g45160:12007.t04155:unspliced-genomic SAC3/GANP family protein, expressed| Length = 10282 Score = 26.7 bits (52), Expect(2) = 2.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 / +1 Query: 124 ADSSNTPAPFPSKSPVMP 177 A + PAPFPS PV P Sbjct: 91 ASTPPAPAPFPSARPVAP 144 Score = 23.1 bits (44), Expect(2) = 2.2 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 / +2 Query: 224 PGPPKLLRHGLSPARPRDLGH*PYPP 301 P PP L L P+ H P PP Sbjct: 161 PPPPPLASRALVPSSLPPHAHPPLPP 238
>LOC_Os10g35010:12010.t02796:unspliced-genomic ATTIC110/TIC110, putative, expressed| Length = 9023 Score = 27.2 bits (53), Expect(2) = 2.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 / +3 Query: 125 PIHQIPLLHFPPRVP 169 P+ +PLL FPPR P Sbjct: 252 PLKPLPLLRFPPRRP 296 Score = 22.6 bits (43), Expect(2) = 2.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 / +2 Query: 38 PQLSRLWSPCPPTVKLTATTV 100 P R SP PPT T TTV Sbjct: 65 PTTRRHPSPPPPTRTTTTTTV 127
>LOC_Os06g14080:12006.t01283:unspliced-genomic ATMAP70-4, putative, expressed| Length = 5684 Score = 26.7 bits (52), Expect(2) = 2.3 Identities = 20/69 (28%), Positives = 25/69 (36%) Frame = +2 / -1 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPRDLGH*PYPPVDANRFRDHAG 334 P P R PSP S P P +R P +PR G PP A+ H Sbjct: 248 PHSPPPPRRPSPDLSPLPGPRPAPTPSTQIRSPPPPHQPRRGGAPTRPPTSADSAAAHRR 69 Query: 335 MPGAENGAP 361 + + AP Sbjct: 68 IGARQTLAP 42 Score = 23.1 bits (44), Expect(2) = 2.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +1 / -3 Query: 349 EWSPLATAIFVEATHCLCSC 408 E +P + A+ + HC C C Sbjct: 60 EANPSSAALRLPQPHCACGC 1
>LOC_Os10g39460:12010.t03188:unspliced-genomic selenium-binding protein-like, putative, expressed| Length = 3184 Score = 27.2 bits (53), Expect(2) = 2.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 166 PVMPPSIANCFQE*IMSRIPWSTEASP 246 P P+ A C Q +SR W+T SP Sbjct: 2567 PQTTPTNATCAQSPTLSRSVWATTTSP 2487 Score = 22.6 bits (43), Expect(2) = 2.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 / -2 Query: 278 LGH*PYPPVDANRFRDHAGMPGAE 349 LGH +PP D+ R R A G E Sbjct: 2508 LGHHHFPPRDSYRSRRRARPSG*E 2437
>LOC_Os09g07720:12009.t00568:unspliced-genomic hypothetical protein| Length = 423 Score = 32.7 bits (65), Expect = 2.4 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 / +1 Query: 223 PWSTEASPPWFKPRSTSRSRALALPSSGCKPLP 321 P+ + PPW +PR +R + +P P P Sbjct: 34 PYPPYSPPPWLRPRFPTRDKCAGIPDFNLPPSP 132
>LOC_Os05g39090:12005.t03451:unspliced-genomic calcium-dependent protein kinase, isoform 2, putative, expressed| Length = 5107 Score = 32.7 bits (65), Expect = 2.4 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 / -2 Query: 41 QLSRLWSPCPPTVKLTATTVRLNLR*AVPIHQI 139 QLSRL P + TATT RLNL +P+ ++ Sbjct: 1230 QLSRLLPPVVSQIPKTATTQRLNLVLKIPVSEL 1132
>LOC_Os01g44260:12001.t03936:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 1980 Score = 32.7 bits (65), Expect = 2.4 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 / +3 Query: 217 RIPWSTEASPPWFKPRSTSRSRALALPSSGCKPLP*SRW 333 R PW+T S W S+ RS + ++GC+ RW Sbjct: 1137 RPPWNTRGSTGWTSSASSPRSSSGPSSATGCRRATSPRW 1253
>LOC_Os01g06970:12001.t00577:unspliced-genomic hypothetical protein| Length = 505 Score = 32.7 bits (65), Expect = 2.4 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 / -1 Query: 140 PLLHFPPRVPLCRLPSPIASRNKS*AEFPGPP 235 P L FP LC+ P P + R S A P PP Sbjct: 115 PPLRFPAHYHLCQRPLPWSERTSSSARTPRPP 20
>LOC_Os01g19290:12001.t01719:unspliced-genomic nodulin-like protein, putative, expressed| Length = 3500 Score = 30.4 bits (60), Expect(2) = 2.4 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 / -3 Query: 118 GRADSSNTPAPFPSKSPVMPPSIANCFQE*IMSRIPWSTEASP 246 G+ +++ P PF S +P PP + E I P ST SP Sbjct: 3048 GKVVAASAPLPFSSTTPPPPPPPSRSDGEPISLAFPHSTMYSP 2920 Score = 23.5 bits (45), Expect(2) = 2.4 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +1 / -2 Query: 226 WSTEASPPWFKPRSTSRSRALALPSSGCKP 315 WS PP P R R+ A SG P Sbjct: 2311 WSRRRRPPCRTPWPARRPRSAAPTPSGTPP 2222
>LOC_Os07g23169:12007.t02017:unspliced-genomic expressed protein| Length = 10494 Score = 32.2 bits (64), Expect(2) = 2.5 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 / -1 Query: 390 PLPLFVHAREGDEPDTCQRATLSRQ*RTAVGR 485 P PL R+ D+P TC R+++ + R +GR Sbjct: 8847 PFPLPCGMRDDDKPPTCSRSSILMECRAVLGR 8752 Score = 23.1 bits (44), Expect(2) = 2.5 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 / -3 Query: 124 ADSSNTPAPFPSKSPVMPPSIANCFQ 201 A S T P S ++PP IA C Q Sbjct: 9568 APSPPTRRPSASSGWLVPPPIARCQQ 9491 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 / +3 Query: 390 PLPLFVHAREGDEPDTCQRATLSRQ*RTAVG 482 P PL R+ DEP TC R+++ + R +G Sbjct: 5079 PFPLPCGMRDDDEPPTCSRSSILMECRAVLG 5171
>LOC_Os04g52510:12004.t04725:unspliced-genomic conserved hypothetical protein| Length = 1149 Score = 26.7 bits (52), Expect(2) = 2.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 / +3 Query: 94 HGQAKFEIGRADSSNTPAPFPSKSPVMPP 180 H + + SS TP+P P++ P PP Sbjct: 318 HRHSTMFAAASTSSATPSPHPARPPPPPP 404 Score = 23.1 bits (44), Expect(2) = 2.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 / +3 Query: 32 PNPQLSRLWSPCPPTVKLTATT 97 P+P +S S PP+ K TAT+ Sbjct: 210 PHPPISAPPSSPPPSPKATATS 275
>LOC_Os11g45280:12011.t04056:unspliced-genomic ATP binding protein, putative, expressed| Length = 7159 Score = 26.7 bits (52), Expect(2) = 3.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -1 / +3 Query: 157 REMEQGYLMNRHGLSQI*PDRGGS 86 RE+E+G + +S+I P+RGG+ Sbjct: 381 RELEEGQAELKREISRIVPERGGA 452 Score = 22.6 bits (43), Expect(2) = 3.0 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = -1 / +1 Query: 97 RGGSEFHRRRTRRPQAAQLGVWEA 26 RG RRR RR + W A Sbjct: 481 RGAPRSRRRRRRRRRRGSCSAWAA 552
>LOC_Os02g30110:12002.t02704:unspliced-genomic cytochrome P450, putative, expressed| Length = 5541 Score = 25.4 bits (49), Expect(2) = 3.0 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 / -2 Query: 176 RLPSPIASRNKS*AEFPGPPKLLRHGLSPARP 271 R P+P R + GP + RHG A P Sbjct: 368 RQPAPTTRRRRGGTRTAGPSRRRRHGEPRAAP 273 Score = 24.0 bits (46), Expect(2) = 3.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 / -2 Query: 344 AENGAP*LPQSSLKPPTASVRAREGRR*T 430 A AP + +PP A+ AR GRR T Sbjct: 200 AAGAAPAARAAQAQPPAATP*ARRGRRRT 114
>LOC_Os02g38804:12002.t005616:unspliced-genomic protein phosphatase type-2C, putative, expressed| Length = 5510 Score = 26.7 bits (52), Expect(2) = 3.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 / +3 Query: 259 PRSTSRSRALALPSSGCKPLP 321 P + SRS L LPS+ PLP Sbjct: 5025 PATRSRSTPLPLPSAAAVPLP 5087 Score = 22.6 bits (43), Expect(2) = 3.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 / +3 Query: 35 NPQLSRLWSPCPPTVKLTATTVRLNLR*AVPIHQIPLLHFPP 160 +P S L+ PT+ LTAT ++ A + P PP Sbjct: 4854 SPAPSLLFRRSTPTLTLTATLTMMSTPPAATMPPRPTTTTPP 4979
>LOC_Os06g17490:12006.t01621:unspliced-genomic protein kinase, putative, expressed| Length = 2562 Score = 25.4 bits (49), Expect(3) = 3.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / +1 Query: 140 PLLHFPPRVPLCRLPSPIASRNKS*AEF 223 P+ PPR P LPS AS + S F Sbjct: 127 PMTRIPPRHPWTLLPSASASPSPSCRSF 210 Score = 23.1 bits (44), Expect(3) = 3.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / +2 Query: 224 PGPPKLLRHGLSPARP 271 PG P+LLR ARP Sbjct: 794 PGVPQLLRRQAGEARP 841 Score = 22.6 bits (43), Expect(3) = 3.2 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 / +1 Query: 17 HQDRFPNPQLSRLWSPCPP 73 HQ P P L S CPP Sbjct: 13 HQQAHPIPLQPPLCSSCPP 69 Score = 26.3 bits (51), Expect(2) = 5.8 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 / -3 Query: 256 KPRSTSRSRALALPSSGCKPLP*SRWYARC 345 + R S R L LPSS + SRW RC Sbjct: 1708 RARPKSPRRGLRLPSSRMLLVLMSRWITRC 1619 Score = 22.1 bits (42), Expect(2) = 5.8 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +3 / -3 Query: 144 CSISLQESRYAAFHRQLLPGINHEQNSLV 230 CS++L + RY+ ++P + E L+ Sbjct: 1807 CSVALPDWRYSGAR*PMVPAVRVETGLLL 1721
>LOC_Os09g37300:12009.t03204:unspliced-genomic sodium/hydrogen exchanger family protein, expressed| Length = 2878 Score = 24.9 bits (48), Expect(2) = 3.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 / +3 Query: 265 STSRSRALALPSSGCKPLP 321 STSRSR P+ G P P Sbjct: 372 STSRSRTWRTPTGGTSPRP 428 Score = 24.4 bits (47), Expect(2) = 3.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 / +3 Query: 130 SSNTPAPFPSKSPVMPPSIANC 195 ++ PAP P SPV P + C Sbjct: 294 ATTCPAPSPRSSPVSPSAAWAC 359
>LOC_Os10g40770:12010.t03316:unspliced-genomic hypothetical protein| Length = 618 Score = 32.2 bits (64), Expect = 3.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 / +3 Query: 217 RIPWSTEASPPWFKPRSTSRSRALALPSS 303 R PW +SP PRS RSR +P+S Sbjct: 276 RRPWRASSSPSTSSPRSQRRSRLCRVPAS 362
>LOC_Os10g22700:12010.t01749:unspliced-genomic ATP binding protein, putative, expressed| Length = 850 Score = 32.2 bits (64), Expect = 3.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 / -1 Query: 161 RVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPR 274 R CR P P A R P PP R +S RPR Sbjct: 169 RARTCRAPCPCAPRRS*APSSPTPPPCRRRSISRRRPR 56
>LOC_Os09g39940:12009.t03458:unspliced-genomic blue copper protein precursor, putative, expressed| Length = 953 Score = 32.2 bits (64), Expect = 3.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 / +1 Query: 106 KFEIGRADSSNTPAPFPSKSPVMPPSIA 189 + ++ +ADSS+ PAP + +P PPS A Sbjct: 559 QIDVVQADSSSAPAPVATTTPPSPPSSA 642
>LOC_Os08g44320:12008.t04156:unspliced-genomic low molecular weight protein-tyrosine-phosphatase slr0328,| putative, expressed Length = 4144 Score = 32.2 bits (64), Expect = 3.3 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +2 / +2 Query: 140 PLLHFPPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPRD 277 P +P R + R P ASR+ + + FP + GL ARPRD Sbjct: 167 PTTRYPVRRRVPRPPLVAASRHCTASPFPTTISISSSGLGQARPRD 304
>LOC_Os06g27590:12006.t02464:unspliced-genomic conserved hypothetical protein| Length = 843 Score = 32.2 bits (64), Expect = 3.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 / -1 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPK 238 PPRVPLC + P+A+ A P PP+ Sbjct: 246 PPRVPLCLVAFPVAASAVVAAPAPVPPR 163
>LOC_Os06g10600:12006.t00938:unspliced-genomic DNA binding protein, putative, expressed| Length = 3070 Score = 32.2 bits (64), Expect = 3.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 / +1 Query: 262 RSTSRSRALALPSSGCKPLP*SRWYA 339 R+ +R RAL LP +P P RWYA Sbjct: 1936 RAPARVRALRLPRRARRPAPHRRWYA 2013
>LOC_Os05g50600:12005.t04492:unspliced-genomic serine carboxypeptidase CPVL precursor, putative, expressed| Length = 1743 Score = 32.2 bits (64), Expect = 3.3 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 / -3 Query: 214 SRIPWSTEASPPWFKPRSTSRSRALALPSSGCKPLP*SRW 333 SR P +T +P PRSTS + PS P P S W Sbjct: 898 SRSPATTARAPSRRPPRSTSPRSSAPPPSPAAPPAPASAW 779
>LOC_Os04g27850:12004.t02488:unspliced-genomic prolyl 4-hydroxylase alpha-1 subunit, putative, expressed| Length = 7021 Score = 32.2 bits (64), Expect = 3.3 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 / -1 Query: 124 ADSSNTPAPFPSKSPVMPPSIANCFQE*IMSRIPWST 234 A ++ PAP PS P PP + + SR PWST Sbjct: 181 ATAAPAPAPSPSPPPPPPPPLLFLARNPDESRRPWST 71
>LOC_Os03g13720:12003.t01165:unspliced-genomic expressed protein| Length = 3001 Score = 32.2 bits (64), Expect = 3.3 Identities = 25/71 (35%), Positives = 29/71 (40%) Frame = +2 / +2 Query: 35 NPQLSRLWSPCPPTVKLTATTVRLNLR*AVPIHQIPLLHFPPRVPLCRLPSPIASRNKS* 214 N L RL P P ++L A R LR I PLL P R P P+ + Sbjct: 161 NEPLGRLALPLPRLLRLRAAVPRHVLRRRRIIRAPPLLPAPAARHAPRPPFPLPAAAPLP 340 Query: 215 AEFPGPPKLLR 247 A P PP LR Sbjct: 341 ARPPPPPPPLR 373
>LOC_Os02g31280:12002.t02820:unspliced-genomic hypothetical protein| Length = 1111 Score = 32.2 bits (64), Expect = 3.3 Identities = 19/75 (25%), Positives = 27/75 (36%) Frame = +1 / -2 Query: 136 NTPAPFPSKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKPRSTSRSRALALPSSGCKP 315 NT S PS++ S P +++ PPW R +P+ P Sbjct: 594 NTTCSPRSSRAAASPSLSTSATPATASTAPRRSQSPPPW*WRRPRHPLSCSTMPTMAAPP 415 Query: 316 LP*SRWYARCREWSP 360 SRW A W+P Sbjct: 414 PGTSRWSASGTWWTP 370
>LOC_Os02g15670:12002.t01360:unspliced-genomic expressed protein| Length = 621 Score = 32.2 bits (64), Expect = 3.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 / -1 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHG 253 PP + R SP+ R + E P PP+L RHG Sbjct: 393 PPSLRHARR*SPVPERLERAREVPTPPRLRRHG 295
>LOC_Os04g02660:12004.t00160:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1818 Score = 27.6 bits (54), Expect(2) = 3.3 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 / -2 Query: 17 HQDRFPNPQLSRLWSPCPP 73 H +R P SRLW P PP Sbjct: 1376 HLERSAIPMNSRLWMPSPP 1320 Score = 24.9 bits (48), Expect(2) = 3.3 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 / -3 Query: 223 PWSTEASPPWFKPRSTSRSRALALPSSG 306 PWS SP P + LA+PSSG Sbjct: 181 PWSNLHSPSRRSPSAHRPRVDLAIPSSG 98
>LOC_Os09g08580:12009.t00652:unspliced-genomic expressed protein| Length = 1183 Score = 26.7 bits (52), Expect(2) = 3.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 / +3 Query: 17 HQDRFPNPQLSRLWSPCPPTVKL 85 H+ R P P RL P PP +L Sbjct: 237 HRPRLPTPDHRRLLLPAPPLPRL 305 Score = 22.6 bits (43), Expect(2) = 3.4 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +1 / +3 Query: 142 PAPFPSKSPVMPP 180 P P P + P++PP Sbjct: 309 PRPLPLRPPLLPP 347
>LOC_Os01g61350:12001.t05514:unspliced-genomic electron transporter, putative, expressed| Length = 1012 Score = 26.7 bits (52), Expect(2) = 3.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 / +2 Query: 5 LLSEHQDRFPNPQLSRLWSPCPPTVKL 85 LLS+H PQL +PC P+V++ Sbjct: 158 LLSDHSPSPTPPQLPPNTAPCSPSVRV 238 Score = 22.6 bits (43), Expect(2) = 3.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 / +1 Query: 143 LLHFPPRVPL 172 LLH PPR PL Sbjct: 337 LLHLPPRRPL 366
>LOC_Os11g01820:12011.t00078:unspliced-genomic ATCHX15, putative, expressed| Length = 3023 Score = 29.0 bits (57), Expect(2) = 3.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 / +1 Query: 124 ADSSNTPAPFPSKSPVMPPS 183 A SS +P+P PS +P PPS Sbjct: 544 APSSPSPSPSPSSTPSAPPS 603 Score = 24.0 bits (46), Expect(2) = 3.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 / +1 Query: 226 WSTEASPPWFKPRSTSRSRALALP 297 W+T PP +PRS S S + P Sbjct: 2440 WATCLPPPTSRPRSLSSSSSSRPP 2511
>LOC_Os12g01820:12012.t00080:unspliced-genomic ATCHX15, putative, expressed| Length = 3047 Score = 29.0 bits (57), Expect(2) = 3.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 / +2 Query: 124 ADSSNTPAPFPSKSPVMPPS 183 A SS +P+P PS +P PPS Sbjct: 416 APSSPSPSPSPSSTPSAPPS 475 Score = 24.0 bits (46), Expect(2) = 3.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 / +1 Query: 226 WSTEASPPWFKPRSTSRSRALALP 297 W+T PP +PRS S S + P Sbjct: 2326 WATCLPPPTSRPRSLSSSSSSRPP 2397
>LOC_Os11g44300:12011.t03958:unspliced-genomic hypothetical protein| Length = 830 Score = 27.6 bits (54), Expect(2) = 3.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 / -2 Query: 125 PIHQIPLLHFPPRVPLCRLPSPI 193 P +PLL PP P C P P+ Sbjct: 718 PAAFLPLLRLPPFPPFCCCPPPL 650 Score = 23.5 bits (45), Expect(2) = 3.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 / -1 Query: 355 SPLATAIFVEATHCLCSC 408 SPLATA+ +E+ L +C Sbjct: 161 SPLATALELESGRILATC 108
>LOC_Os01g23820:12001.t02108:unspliced-genomic hypothetical protein| Length = 459 Score = 27.2 bits (53), Expect(2) = 4.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 / +1 Query: 198 EAIGDGRRHNGTLGGKWSR 142 E GDG R G LG +W R Sbjct: 373 EPRGDGAREGGKLGRRWRR 429 Score = 23.1 bits (44), Expect(2) = 4.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 / +3 Query: 251 HGGEASVDQGILLMIYSWKQLAMEGG 174 +GG+ VD+ +LL+ EGG Sbjct: 78 NGGDGGVDEVLLLLAMPMVATTTEGG 155
>LOC_Os08g33190:12008.t03061:unspliced-genomic linker histone H1 and H5 family protein, expressed| Length = 3253 Score = 26.7 bits (52), Expect(2) = 4.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 / +3 Query: 303 WMQTASVITLVCQVQRMEPPSYRNLR*SHPLPLFV 407 W + AS L V ++ PP ++L P+PL V Sbjct: 2658 WRRQASACVL*SAVWQLSPPELQSLAVC*PVPLLV 2762 Score = 22.1 bits (42), Expect(2) = 4.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / +3 Query: 146 LHFPPRVPLCRLPSPIAS 199 L P R +CR PSP S Sbjct: 2562 LRCPRRYDVCRPPSPCPS 2615
>LOC_Os12g01690:12012.t00067:unspliced-genomic prenylated Rab receptor 2, putative| Length = 663 Score = 28.1 bits (55), Expect(2) = 4.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 / +2 Query: 130 SSNTPAPFPSKSPVMPPSIAN 192 SS TP+P P SP PP ++ Sbjct: 314 SSPTPSPLPRSSPSSPPGASS 376 Score = 22.6 bits (43), Expect(2) = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 / +2 Query: 265 STSRSRALALPSSGCKP 315 STS++R A P S C P Sbjct: 581 STSQTRPTAPPPSTCSP 631
>LOC_Os07g30930:12007.t02780:unspliced-genomic EMB2745, putative, expressed| Length = 2787 Score = 26.3 bits (51), Expect(2) = 4.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 / +3 Query: 239 LLRHGLSPARPRDLGH*PYPPVDANR 316 L+ H ++ ARPR L H P P A R Sbjct: 153 LVPHPVAVARPRRLPHPPLPSRHARR 230 Score = 22.6 bits (43), Expect(2) = 4.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 / +2 Query: 121 RADSSNTPAPFPSKSPVMPP 180 R +S TPA P P PP Sbjct: 104 RTPTSRTPARTPPPPPPRPP 163
>LOC_Os01g04230:12001.t00312:unspliced-genomic receptor kinase, putative, expressed| Length = 2455 Score = 25.8 bits (50), Expect(2) = 4.3 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 / -3 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPR 274 PP P C PS R + P PP P R R Sbjct: 2021 PPSPPRCPCPSSAPGRTPPTSTPPSPPTAPTAAAPPPRRR 1902 Score = 23.1 bits (44), Expect(2) = 4.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 / -3 Query: 313 PLP*SRWYARCREWSPLATAI 375 P P RW ARC +P A + Sbjct: 1919 PPPRRRWEARCPGTAPSAARV 1857
>LOC_Os02g46990:12002.t04285:unspliced-genomic ATPase family AAA domain-containing protein 3, putative, expressed| Length = 4659 Score = 31.8 bits (63), Expect = 4.5 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 / +2 Query: 359 GLHSLHLAYQRDHGSGLHPLEGKANARDLEVERGLNHGGEASVDQGI 219 GLH + H G G+A RD+E G GGE + G+ Sbjct: 413 GLHRSGWVFLGLHSYGGFSTRGRAGLRDIEAAGGCAEGGEPDEEGGV 553
>LOC_Os02g09690:12002.t00816:unspliced-genomic expressed protein| Length = 10310 Score = 31.8 bits (63), Expect = 4.5 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -3 / +3 Query: 233 VDQGILLMIYSWKQLAMEGGITGLLEGNGAGVFDESA 123 V IL MI QL M+GG+ GLLE N A + A Sbjct: 7287 VIHSILKMILFLIQLQMDGGLAGLLERNYAAAATKKA 7397
>LOC_Os01g53860:12001.t04803:unspliced-genomic hypothetical protein| Length = 3311 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 / +3 Query: 425 ISFPRVHEQRQWVASTKIAVARGLHS 348 ISF R H Q +W IAV+R +H+ Sbjct: 474 ISFGRYHLQTEWYLEVLIAVSRSIHA 551
>LOC_Os12g01760:12012.t00074:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 3653 Score = 30.4 bits (60), Expect(2) = 4.5 Identities = 18/66 (27%), Positives = 28/66 (42%) Frame = +1 / +1 Query: 124 ADSSNTPAPFPSKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKPRSTSRSRALALPSS 303 + + + P P +SP PPS + S P S + P P STS + A + P + Sbjct: 247 SSAPSAPTSSPPRSPATPPSPTSISPSAPASPTPPSPRSPPRRSSPPSTSPAPAGSAPPA 426 Query: 304 GCKPLP 321 + P Sbjct: 427 SPRSSP 444 Score = 22.6 bits (43), Expect(2) = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +2 Query: 491 NSKRRMPWSTFSFP 532 N+ R M W FSFP Sbjct: 2660 NALRSMTWE*FSFP 2701
>LOC_Os12g38064:12012.t03486:unspliced-genomic metallothionein-like protein 1, putative, expressed| Length = 1173 Score = 31.8 bits (63), Expect = 4.5 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -2 / -3 Query: 558 KIFDGNTYLGKENVLHGIRLLELKTYLRLCATDGRGWLADRYRVHLLPSR 409 +IF +LGK++ + I LL T C++DG L + RVHL R Sbjct: 574 RIFFWLAFLGKDSSISFIPLLRCNTEDSGCSSDGGVDLLSQVRVHLSEPR 425
>LOC_Os11g28184:12011.t02431:unspliced-genomic expressed protein| Length = 8196 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 / +2 Query: 140 PLLHFPPRVPLCRLPSPIASRNKS 211 P FPP +P RLPSP SR S Sbjct: 6359 PFSFFPPPLPRARLPSPPLSRTPS 6430
>LOC_Os10g30550:12010.t02387:unspliced-genomic phosphoglycerate kinase, chloroplast precursor, putative, expressed| Length = 8882 Score = 31.8 bits (63), Expect = 4.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 / -3 Query: 100 QAKFEIGRADSSNTPAPFPSKSPVMPP 180 QA+ IG A S N P P PS S +PP Sbjct: 309 QAQRTIGTAASPNAPNPLPSFSASLPP 229
>LOC_Os09g34110:12009.t02987:unspliced-genomic expressed protein| Length = 6298 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 / +2 Query: 226 WSTEASPPWFKPRSTSRSRALALPSSGCK 312 W +PP ++ R SR RA +PS+GC+ Sbjct: 1625 WCPCQAPPAYEHRC*SRRRASVIPSAGCQ 1711
>LOC_Os09g03660:12009.t00263:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3086 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 / -2 Query: 325 SRWYARCREWSPLATAIFVEATHCLCSCTRGKEM 426 S W + CR SP A++ +EAT C T M Sbjct: 2128 SAWASYCRRMSPSASSRMLEATRAACHSTSVSRM 2027
>LOC_Os06g10070:12006.t00885:unspliced-genomic expressed protein| Length = 765 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 / -2 Query: 229 STEASPPWFKPRSTSRSRALALPSSGCKP 315 S +PPW RST R+RA P++ P Sbjct: 437 SVAGAPPWAFARSTPRARAAQAPTTSAAP 351
>LOC_Os05g07820:12005.t00663:unspliced-genomic leucine-rich repeat receptor protein kinase EXS precursor, putative,| expressed Length = 4968 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 / +3 Query: 265 STSRSRALALPSSGCKPLP*SRWYARCR 348 ++ RSR+ A PSS P +RW A CR Sbjct: 3360 ASCRSRSAASPSSASSPCTTTRWRAPCR 3443
>LOC_Os04g54600:12004.t04932:unspliced-genomic plant-specific domain TIGR01570 family protein, expressed| Length = 1129 Score = 31.8 bits (63), Expect = 4.5 Identities = 19/72 (26%), Positives = 30/72 (41%) Frame = +1 / +1 Query: 157 SKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKPRSTSRSRALALPSSGCKPLP*SRWY 336 S + PP+ A+C++ R + A P ++SR+ + G P RW Sbjct: 610 SATSAPPPARASCWRARSARRTAATAPAPAPARGASASSRTGGCSRSPCGPCPATARRWG 789 Query: 337 ARCREWSPLATA 372 RC E P T+ Sbjct: 790 TRCGETRPTTTS 825
>LOC_Os04g45090:12004.t04044:unspliced-genomic cytochrome b561, putative, expressed| Length = 2388 Score = 31.8 bits (63), Expect = 4.5 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +2 / +3 Query: 386 PPTASVRAREGRR*TRYLSASHPLPSVAHSRR*VFNSKRRMPW 514 PP A R EGRR R S + LP A RR + R PW Sbjct: 186 PPRAHKREEEGRRRDRSKSEARWLPGWA*RRRRSRTWRTRWPW 314
>LOC_Os04g40770:12004.t03638:unspliced-genomic F-box domain containing protein| Length = 3342 Score = 31.8 bits (63), Expect = 4.5 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 / -2 Query: 139 TPAPFPSKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKPRS 267 +P P PS P PS A Q+ I + W + SPPW P S Sbjct: 3059 SPRPSPSPLPSPSPSPAAAPQDSIGAVRIWWSLPSPPWAGPLS 2931
>LOC_Os04g32540:12004.t02933:unspliced-genomic serine carboxypeptidase K10B2.2 precursor, putative, expressed| Length = 3666 Score = 31.8 bits (63), Expect = 4.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 / -2 Query: 244 PPWFKPRSTSRSRALALPSSGCKPLP*SRWYARCRE 351 PPW+ P + R P++ + P +W CRE Sbjct: 155 PPWWPPPLPTTRRHCRRPAAAARRTPPQQWRLSCRE 48
>LOC_Os04g08560:12004.t00724:unspliced-genomic protein phosphatase 2C containing protein, expressed| Length = 6201 Score = 31.8 bits (63), Expect = 4.5 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 / -1 Query: 161 RVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPR 274 R P CR +P A R ++ P PP R G A PR Sbjct: 426 RRPPCRASAPRARRTRTRRATPRPPSTPRTGAGAAAPR 313
>LOC_Os03g60260:12003.t05268:unspliced-genomic ANT1, putative, expressed| Length = 1752 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 / -2 Query: 223 PWSTEASPPWFKPRSTSRSRALA 291 PW+ +ASP KP ST+R ALA Sbjct: 1505 PWAAKASPRSKKPPSTARRHALA 1437
>LOC_Os02g18784:12002.t005528:unspliced-genomic expressed protein| Length = 917 Score = 31.8 bits (63), Expect = 4.5 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 / +3 Query: 251 GLSPARPRDLGH*PYPPVDANRFRDHAGMPG 343 G PA P LGH P PP A FR +G G Sbjct: 177 GDPPAAPLPLGHSPLPPPAALSFRHESGGGG 269
>LOC_Os01g48780:12001.t04320:unspliced-genomic transposon protein, putative, unclassified| Length = 1428 Score = 26.3 bits (51), Expect(2) = 4.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 / +2 Query: 189 GDGRRHNGTLGGKWSR 142 G GRR +GT G W R Sbjct: 494 GGGRRGSGTRAGSWGR 541 Score = 22.6 bits (43), Expect(2) = 4.5 Identities = 21/79 (26%), Positives = 24/79 (30%) Frame = -3 / +1 Query: 458 GEGGSLTGIGFISFPRVHEQRQWVASTKIAVARGLHSLHLAYQRDHGSGLHPLEGKANAR 279 GE G+GFI R W A +RG LH Q +G R Sbjct: 175 GEDWFGEGLGFIGRQCRFGNRPWTALGGEGASRGRDRLHGRGQTARRTGWRGAAAPLPWR 354 Query: 278 DLEVERGLNHGGEASVDQG 222 L E G E G Sbjct: 355 *LRAEGEQRPGRERKAGNG 411
>LOC_Os04g24160:12004.t02130:unspliced-genomic hypothetical protein| Length = 1228 Score = 26.7 bits (52), Expect(2) = 4.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 / -3 Query: 221 FPGPPKLLRHGLSPARP 271 +P PP+L R +PARP Sbjct: 548 WPAPPRLPRRSSAPARP 498 Score = 22.1 bits (42), Expect(2) = 4.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 / -1 Query: 125 PIHQIPLLHFPPRVPLCRLPSPIASRNKS*AEFP 226 P H P H PP LPS + S A +P Sbjct: 769 PSHTPPPSHTPPPSSRTLLPSRTPPPSSSAARWP 668
>LOC_Os03g60100:12003.t05253:unspliced-genomic 50S ribosomal protein L17, putative, expressed| Length = 1930 Score = 30.4 bits (60), Expect(2) = 4.6 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +2 / +2 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPR 274 PPR P R P P + +S P PP R G S R R Sbjct: 92 PPRPPRRRSPCPPGACRRSAPRSPPPPAPPRRGSSGRRSR 211 Score = 21.7 bits (41), Expect(2) = 4.6 Identities = 12/43 (27%), Positives = 16/43 (37%) Frame = +1 / +2 Query: 262 RSTSRSRALALPSSGCKPLP*SRWYARCREWSPLATAIFVEAT 390 R R A + PS P S + +EW F+E T Sbjct: 221 RPRRRRSAASAPSPASPPFRLSSPSGKVKEWHLYCPRDFIELT 349
>LOC_Os03g04820:12003.t00358:unspliced-genomic conserved hypothetical protein| Length = 792 Score = 26.3 bits (51), Expect(2) = 4.7 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 / -2 Query: 238 ASPPWFKPRSTSRSRALALPSSGCKPLP*SRWYARCR 348 ASPP + PR + PS P P + RCR Sbjct: 152 ASPPSWSPRPRTPPPRPRAPSHAFVPFPGTPTVTRCR 42 Score = 22.6 bits (43), Expect(2) = 4.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +2 / -3 Query: 167 PLCRLPSPIASRNKS*AEFPGPP 235 P R P P SR ++ P PP Sbjct: 256 PSRRAPCPATSRRRTVRPLPPPP 188
>LOC_Os11g14690:12011.t01300:unspliced-genomic hypothetical protein| Length = 720 Score = 26.3 bits (51), Expect(2) = 4.7 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 / -1 Query: 248 HGLSPARPRDL 280 HGL+P RPRD+ Sbjct: 189 HGLTPCRPRDM 157 Score = 22.6 bits (43), Expect(2) = 4.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 / -1 Query: 133 SNTPAPFPSKSPVMPPSIANCFQ 201 S TP P S +P S+ C Q Sbjct: 315 SATPTPCQLSSRCIPHSVRGCIQ 247
>LOC_Os06g41270:12006.t03820:unspliced-genomic hypothetical protein| Length = 396 Score = 24.4 bits (47), Expect(2) = 4.9 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 / -2 Query: 145 APFPSKSPVMPPSIANCFQE*IMSRIPWSTEASP 246 +PFPS PP A+ F S P + ASP Sbjct: 386 SPFPSSPVATPPLPASSFSFLGASHPPAACAASP 285 Score = 24.4 bits (47), Expect(2) = 4.9 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +3 / -2 Query: 342 VQRMEPPSYRNLR*SHPLPLFVHAREGDEPDTCQRATL 455 V+R+ PS HP P G+ PD C R L Sbjct: 284 VRRLMSPSPSPALRRHPPPRPPRILAGNSPDRCPRRRL 171
>LOC_Os02g38780:12002.t03516:unspliced-genomic protein phosphatase 2C containing protein, expressed| Length = 10174 Score = 24.9 bits (48), Expect(2) = 5.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 / +3 Query: 130 SSNTPAPFPSKSPVMPP 180 S +TP P PS + V PP Sbjct: 9579 SRSTPLPLPSAAAVPPP 9629 Score = 23.5 bits (45), Expect(2) = 5.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 / +3 Query: 35 NPQLSRLWSPCPPTVKLTATTVRLNLR*AVPIHQIPL 145 +P + L+ PT+ LTAT ++ P IPL Sbjct: 9429 SPAPTLLFRRSTPTLTLTATPAMMSTTTTPPTRLIPL 9539
>LOC_Os07g04590:12007.t00347:unspliced-genomic hypothetical protein| Length = 1701 Score = 26.7 bits (52), Expect(2) = 5.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / +1 Query: 32 PNPQLSRLWSPCPPTVKLTATT 97 P PQ + W+P PPT A T Sbjct: 715 PVPQAASTWAPPPPTSPPAAAT 780 Score = 24.9 bits (48), Expect(2) = 5.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 / +1 Query: 136 NTPAPFPSKSPVMPPS 183 + PAP P+ +P PPS Sbjct: 1600 DAPAPAPAPAPAPPPS 1647
>LOC_Os01g65992:12001.t06842:unspliced-genomic expressed protein| Length = 911 Score = 25.4 bits (49), Expect(2) = 5.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 / +2 Query: 124 ADSSNTPAPFPSKSPVMPPS 183 A +S P+P PS S +PP+ Sbjct: 266 APASTAPSPAPSCSSALPPA 325 Score = 25.4 bits (49), Expect(2) = 5.7 Identities = 11/38 (28%), Positives = 14/38 (36%) Frame = +1 / +2 Query: 232 TEASPPWFKPRSTSRSRALALPSSGCKPLP*SRWYARC 345 T ++PPW S+ R P RW RC Sbjct: 494 TSSTPPWPSSPSSRSPRRTTTSCCATTPACPGRW*TRC 607
>LOC_Os12g42280:12012.t03902:unspliced-genomic viviparous-14, putative, expressed| Length = 2563 Score = 25.4 bits (49), Expect(2) = 5.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 / -1 Query: 188 PIASRNKS*AEFPGPPKLLRHGLSPARP 271 P +S A P PP +HG P RP Sbjct: 1774 PSSSPRAGDAAAPAPPMGTKHGSPPNRP 1691 Score = 23.1 bits (44), Expect(2) = 5.8 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 / -2 Query: 290 PYPPVDANRFRDHAGMPGAENGAP*LPQSSLKPPTASVRAREGRR 424 P+ R R + A G+P P+ S PP A+ R RR Sbjct: 1629 PWATARRRRGRRTSSSGRAWRGSPCRPRGSPAPPAAARRGGWTRR 1495
>LOC_Os03g62370:12003.t05462:unspliced-genomic WD40-like Beta Propeller Repeat family protein, expressed| Length = 2328 Score = 25.4 bits (49), Expect(2) = 5.8 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +1 / +1 Query: 226 WSTEASPPWFKPRSTSRSRALALPSSGCKPLP*SRWYARCRE 351 WS E S KPR+ +RSR +S P S AR E Sbjct: 1999 WSPETSARRCKPRAGARSRIATGSTSKMLPNLKSSTMARAAE 2124 Score = 23.1 bits (44), Expect(2) = 5.8 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 / +1 Query: 94 HGQAKFEIGRADSSNTPAPFPSKSPVM 174 HG A+ + TP PS+SP + Sbjct: 1804 HGSARTPRASSSPPTTPPSPPSRSPTL 1884
>LOC_Os06g36310:12006.t03328:unspliced-genomic receptor-like protein kinase 5 precursor, putative, expressed| Length = 1823 Score = 24.9 bits (48), Expect(2) = 6.0 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 / +2 Query: 244 PPWFKPRSTSRSRALALPSSGCKPLP 321 P W + R +SR + A S GC P Sbjct: 497 PGWRRSRRSSRCTSTATGSQGCTRRP 574 Score = 23.5 bits (45), Expect(2) = 6.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 / +3 Query: 119 AVPIHQIPLLHFPPRVPLCRLPSPI 193 A P+ P H P R L LP+P+ Sbjct: 306 ARPLQHRPPRHLPRRDALPMLPAPV 380
>LOC_Os02g53280:12002.t04907:unspliced-genomic expressed protein| Length = 2653 Score = 26.3 bits (51), Expect(2) = 6.0 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = -3 / +2 Query: 260 GLNHGGEASVDQGILLMIYSWKQLAMEGGITGLLEGNGAGVFDESARPI 114 G + G+ D G+L K L +EGG L + ARP+ Sbjct: 2366 GHSFTGKEKRDTGVLYPFAVVKPLGLEGGGAATLNDVNQRILKRPARPV 2512 Score = 25.8 bits (50), Expect(2) = 6.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 / +3 Query: 459 GRGWLADRYRVHLLPSRARTEAVGGFNEDCGS 364 G GW+ DR+ + + TEAV G S Sbjct: 1773 GWGWVGDRWAIITRRACVATEAVAGIGAGSSS 1868
>LOC_Os03g33450:12003.t02936:unspliced-genomic conserved hypothetical protein| Length = 967 Score = 25.8 bits (50), Expect(2) = 6.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 / -2 Query: 133 SNTPAPFPSKSPVMPPSIA 189 S P P P +SP+ PP A Sbjct: 915 SPVPPPLPRRSPLAPPPTA 859 Score = 24.9 bits (48), Expect(2) = 6.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 / -3 Query: 166 PVMPPSIANCFQE*IMSRIPWSTEASPP 249 P PP I E I+ R P S SPP Sbjct: 401 PRPPPPIVEIPSEIILPRTPVSPSISPP 318
>LOC_Os07g39880:12007.t03649:unspliced-genomic exodeoxyribonuclease V, putative, expressed| Length = 1883 Score = 29.5 bits (58), Expect(2) = 6.1 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +1 / +2 Query: 268 TSRSRALALPSSGCKPLP*SRWYARCREWSP 360 T R+R A PSS P P S A R WSP Sbjct: 698 TRRARCSACPSSTAPPRPPSAARAPSRCWSP 790 Score = 22.1 bits (42), Expect(2) = 6.1 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 / +2 Query: 142 PAPFPSKSPVMPP 180 P PFPS+ PP Sbjct: 71 PFPFPSRRTASPP 109
>LOC_Os11g24150:12011.t02036:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6060 Score = 31.3 bits (62), Expect = 6.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 / -1 Query: 120 PCRFIKYPCSISLQESRYAAFHRQLLPGINHEQNSLVH 233 PCR YPC + + R H ++L G+ + S++H Sbjct: 447 PCRLGSYPCRLVILVGRTRFGHTRILLGLRCRRCSVLH 334
>LOC_Os12g26430:12012.t02357:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2310 Score = 24.9 bits (48), Expect(3) = 6.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / -1 Query: 332 GMPGAENGAP*LPQSSLKPPT 394 G G NGA Q S+KPPT Sbjct: 867 GKQGGGNGATAPGQGSVKPPT 805 Score = 23.1 bits (44), Expect(3) = 6.1 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 / -2 Query: 155 PPRVPLCRLPSP 190 PPR+ LC P+P Sbjct: 1679 PPRLRLCSTPTP 1644 Score = 21.7 bits (41), Expect(3) = 6.1 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 / -3 Query: 224 PGPPKLLRHGLSPARPRDLGH*PYPPVDANRFRDHAGMP 340 P P LR PAR LG + A R H G+P Sbjct: 1408 PPPRSSLRRHHRPARLDYLGTSVPRQLRAPRHHAHGGLP 1292
>LOC_Os10g32730:12010.t02581:unspliced-genomic haloacid dehalogenase-like hydrolase domain-containing protein 1A,| putative, expressed Length = 4695 Score = 31.3 bits (62), Expect = 6.2 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 / -1 Query: 365 LPQSSLKPPTASVRAREGRR*TRYLSASHPLPSVAHSRR 481 +PQS+ PPT R+R R TR + ++P H RR Sbjct: 360 IPQSNPIPPTRLSRSRSYRARTRQRTRTNPAARGRHQRR 244
>LOC_Os08g44050:12008.t04130:unspliced-genomic INDETERMINATE-related protein 1, putative, expressed| Length = 6577 Score = 31.3 bits (62), Expect = 6.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 / +1 Query: 226 WSTEASPPWFKPRSTSRSRALALPS 300 W + ASP W P S++RSR PS Sbjct: 5152 WPSAASPAWPPPTSSNRSRTTPPPS 5226
>LOC_Os06g30640:12006.t02767:unspliced-genomic cytochrome P450 76C2, putative, expressed| Length = 1678 Score = 31.3 bits (62), Expect = 6.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 / -3 Query: 229 STEASPPWFKPRSTSRSRALALPSSGCKPLP 321 S A+PP +P + +R+RA A P G P P Sbjct: 1505 SRRAAPPTCRPAAATRTRAAATP**GAAPAP 1413
>LOC_Os05g51790:12005.t04604:unspliced-genomic ATP binding protein, putative, expressed| Length = 12664 Score = 31.3 bits (62), Expect = 6.2 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +2 / -2 Query: 491 NSKRRMPWSTFSFPKYV 541 NSK+++PW+ FPKY+ Sbjct: 6102 NSKKKLPWTLSHFPKYL 6052
>LOC_Os04g20000:12004.t01740:unspliced-genomic conserved hypothetical protein| Length = 495 Score = 31.3 bits (62), Expect = 6.2 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 / +1 Query: 97 RGGSEFHRRRTRRPQAAQL 41 RGG HRRR RRP+AA + Sbjct: 370 RGGERDHRRRGRRPKAATM 426
>LOC_Os04g13470:12004.t01167:unspliced-genomic expressed protein| Length = 13910 Score = 31.3 bits (62), Expect = 6.2 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 / -3 Query: 97 RGGSEFHRRRTRRPQAAQLGVWEA 26 RG E RRR RR ++G+WEA Sbjct: 93 RGLGEARRRRRRRHGEGEIGIWEA 22
>LOC_Os04g10400:12004.t00873:unspliced-genomic electron transfer flavoprotein beta-subunit, putative, expressed| Length = 3743 Score = 31.3 bits (62), Expect = 6.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 / +3 Query: 230 PPKLLRHGLSPARPRDLGH*PYPPVDANRFRDHAGMPGA 346 PP RHG P RPR P PP R R P A Sbjct: 300 PPHRARHGRRPRRPRPPRPRPLPPPPPPRRRQDPPRPRA 416
>LOC_Os03g58280:12003.t05088:unspliced-genomic hypothetical protein| Length = 2576 Score = 31.3 bits (62), Expect = 6.2 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 / +3 Query: 143 LLHFPPRVPLCRLPSPIASRNKS*AEFPGPPKLLR 247 L+ PPR LCRL P+ R P PP+L R Sbjct: 285 LVRPPPRRRLCRLVLPLPRRRPPRRPPPHPPRLAR 389
>LOC_Os03g47970:12003.t05722:unspliced-genomic GATA transcription factor 25, putative, expressed| Length = 4412 Score = 31.3 bits (62), Expect = 6.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 / -2 Query: 119 AVPIHQIPLLHFPPRVPLCRLP 184 A P+H+ P H PPR LCR P Sbjct: 298 AAPLHRPPRRHPPPRPLLCRHP 233
>LOC_Os03g46690:12003.t04036:unspliced-genomic F-box domain containing protein, expressed| Length = 2728 Score = 31.3 bits (62), Expect = 6.2 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +1 / +2 Query: 121 RADSSNTPAPFPSKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKPRSTSRSRALALP 297 RA S A +P P+ A+C +R P ST A+ P P +TSR + A P Sbjct: 68 RARSRRPAASPRRGAPPSTPAAASCAGASSRARSPGSTSATSPPPPPPATSRGSSPAAP 244
>LOC_Os03g38570:12003.t03300:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6173 Score = 31.3 bits (62), Expect = 6.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 / +3 Query: 386 PPTASVRAREGRR*TRYLSASHPLPSVAHSRR 481 PP V+AR RR ++L SHP + H RR Sbjct: 2253 PPRRDVQARGWRREAQHLRPSHPEATDGHVRR 2348
>LOC_Os03g29410:12003.t02564:unspliced-genomic protein kinase APK1B, chloroplast precursor, putative, expressed| Length = 4926 Score = 31.3 bits (62), Expect = 6.2 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 / -1 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARP 271 PP P P+P +SR + A P P LLR P P Sbjct: 549 PPATPTAPAPTPCSSRP*TTAAAPPPMMLLRRASPPPPP 433
>LOC_Os02g45810:12002.t04168:unspliced-genomic transparent testa glabra 1 protein, putative, expressed| Length = 3101 Score = 31.3 bits (62), Expect = 6.2 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 / +1 Query: 32 PNPQLSRLWSPCPPTVKLTATTVRLNLR*AVPIHQIPL 145 P P+L L P PP +L R LR +P HQ P+ Sbjct: 349 PQPRLPPLLRPRPPHRRLLPRPPRALLRPPLPAHQAPV 462
>LOC_Os01g67390:12001.t06096:unspliced-genomic extensin-1 precursor, putative, expressed| Length = 2444 Score = 31.3 bits (62), Expect = 6.2 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +2 / +1 Query: 149 HFPPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPRDLGH*PYPPVD 307 + PP+VPL P A+ + + PP L G+S P + PPV+ Sbjct: 1774 YLPPKVPLEMSPPAHATSPQPLVHYSPPPPLQHAGISSTTPSVNSYQSPPPVN 1932
>LOC_Os03g50130:12003.t04357:unspliced-genomic microsomal glutathione S-transferase 3, putative, expressed| Length = 1982 Score = 29.9 bits (59), Expect(2) = 6.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 / -1 Query: 214 SRIPWSTEASPPW 252 +RIPWS ++PPW Sbjct: 146 TRIPWSARSTPPW 108 Score = 21.7 bits (41), Expect(2) = 6.4 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / -2 Query: 50 RLWSPCPPT 76 R W PC PT Sbjct: 397 RAWRPCSPT 371
>LOC_Os02g01590:12002.t00059:unspliced-genomic beta-fructofuranosidase 1 precursor, putative, expressed| Length = 4140 Score = 27.6 bits (54), Expect(2) = 6.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 / -2 Query: 223 PWSTEASPPWFKPRSTSRSR 282 PW T A+ PW P + S R Sbjct: 3341 PWGTPATSPWTSPPARSSRR 3282 Score = 24.9 bits (48), Expect(2) = 6.7 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +1 / -2 Query: 328 RWYARCREW 354 RW++RCR W Sbjct: 1136 RWWSRCRAW 1110
>LOC_Os04g19140:12004.t01654:unspliced-genomic expressed protein| Length = 2951 Score = 26.7 bits (52), Expect(2) = 6.7 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 / -2 Query: 244 PPWFKPRSTSRSRALALPSSGCKPLP 321 PPW P S RS + P PLP Sbjct: 418 PPWHAPASARRSASSPPPPPRPAPLP 341 Score = 25.4 bits (49), Expect(2) = 6.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 / -2 Query: 155 PPRVPLCRLPSPIASR 202 PP P CR PSP R Sbjct: 1786 PPSAPCCRPPSPRGRR 1739
>LOC_Os08g01830:12008.t00082:unspliced-genomic receptor protein kinase CRINKLY4 precursor, putative, expressed| Length = 3080 Score = 29.9 bits (59), Expect(2) = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +2 / -2 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPRDLGH*PYPP 301 PP P R P+ +R++S PP R + ARP P PP Sbjct: 2377 PPTSPAARAPAAARTRSRSSPRATPPPPRSRAAPARARP*SSRRRPPPP 2231 Score = 22.1 bits (42), Expect(2) = 6.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 / -1 Query: 455 LPSVAHSRR*VFNSKRRMPWS 517 LP+VAH+ V R +PW+ Sbjct: 1049 LPTVAHAPGMVSLKMRCLPWN 987
>LOC_Os09g23200:12009.t02004:unspliced-genomic myb-like DNA-binding domain, SHAQKYF class family protein| Length = 6838 Score = 24.4 bits (47), Expect(2) = 7.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 / +2 Query: 395 ASVRAREGRR*TRYLSASHPLPSVAHSRR 481 A+ R R RR YLS + P S + SRR Sbjct: 1418 AAARRRRRRRSAGYLSTTAPAGSRSCSRR 1504 Score = 23.5 bits (45), Expect(2) = 7.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 / +1 Query: 220 IPWSTEASPPWFKPRSTSRSRALAL 294 +PW SPP +TS + A AL Sbjct: 1309 LPWRHRPSPPSSAVATTSAAAAAAL 1383
>LOC_Os01g52640:12001.t04690:unspliced-genomic ubiquitin-protein ligase COP1, putative, expressed| Length = 6187 Score = 24.4 bits (47), Expect(2) = 7.2 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 / -2 Query: 91 HHGQAKFEIGRADSSNTPAPFPSKSPVMPP 180 H G + GR+ S PS P++PP Sbjct: 756 HSGASTARPGRSSHSRRLTSPPSSPPLLPP 667 Score = 23.5 bits (45), Expect(2) = 7.2 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +1 / -2 Query: 175 PPSIANCFQE*IMSRIPWSTEASPPWFKPRSTSRSRALALPSSGCKPLP*SRWYAR 342 PP+ A+ + I + P + P + RS RAL L +P P S W ++ Sbjct: 573 PPATASTREPSIPAAHPPTHPTHPGYPMARSPPIRRALRLHPLLPRPHPGSEWQSK 406
>LOC_Os03g59650:12003.t05211:unspliced-genomic BRCA1 C Terminus domain containing protein, expressed| Length = 5692 Score = 25.4 bits (49), Expect(2) = 7.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 / +2 Query: 238 ASPPWFKPRSTSRSRALALPSSGC 309 +SPP+ PRS +R+ A + ++ C Sbjct: 140 SSPPFSLPRSRARAAAFVVGAAEC 211 Score = 22.6 bits (43), Expect(2) = 7.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 / +1 Query: 68 PPTVKLTATTVRLNLR*AVPIHQIPLLHFPP 160 PP + ATT R + R* P Q+ + PP Sbjct: 73 PPPCRPAATTPRASPR*PRPSSQLSPILPPP 165
>LOC_Os09g12720:12009.t01062:unspliced-genomic protein binding protein, putative, expressed| Length = 5202 Score = 24.0 bits (46), Expect(2) = 7.4 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = +1 / +2 Query: 91 HHGQAKFEIGRADSSNTPAPFPSKSPVMPPSIAN 192 HH + GR + S S + PP IA+ Sbjct: 3854 HHALGHYPCGRVMPLQQHCQYSSSSMLSPPQIAS 3955 Score = 24.0 bits (46), Expect(2) = 7.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 / +1 Query: 259 PRSTSRSRALALPSSGCKP 315 P SR+ A PSSGC+P Sbjct: 3979 PLRQSRATASHGPSSGCQP 4035
>LOC_Os01g47710:12001.t04217:unspliced-genomic homeobox domain containing protein, expressed| Length = 4361 Score = 24.4 bits (47), Expect(2) = 7.5 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +1 / +3 Query: 277 SRALALPSSGCKPLP*SRWYARCREWSPL 363 +R LP+ +PLP R R W P+ Sbjct: 1143 TRRAGLPAVAAEPLPVGRRPRRRHSWRPV 1229 Score = 23.5 bits (45), Expect(2) = 7.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 / +2 Query: 344 AENGAP*LPQSSLKPPTASVRAREGRR 424 A GAP + PP +S AR RR Sbjct: 1340 AAPGAPGSASTGAAPPISSASARAARR 1420
>LOC_Os03g60380:12003.t05277:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 3465 Score = 24.4 bits (47), Expect(2) = 7.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / -2 Query: 386 PPTASVRAREGRR*TRYLSASHPLPSVA 469 PP A++R R R R S P PS A Sbjct: 656 PPPAALRRRPWPRAARSASPPPPAPSAA 573 Score = 23.5 bits (45), Expect(2) = 7.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 / -2 Query: 259 PRSTSRSRALALPSSGCKPLP*SRWYARCREWS 357 PRS+ S+ + + P SR +AR R W+ Sbjct: 761 PRSSRSSQGQSSSARRAPRRPASRGWARWRRWT 663
>LOC_Os02g35220:12002.t03160:unspliced-genomic expressed protein| Length = 3354 Score = 25.8 bits (50), Expect(2) = 7.6 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 / +2 Query: 48 LNWGFGKRSWCS 13 ++WG KR WC+ Sbjct: 581 MHWGLSKRRWCN 616 Score = 22.1 bits (42), Expect(2) = 7.6 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -1 / +2 Query: 205 IPGSNWRWK 179 IP NW+WK Sbjct: 515 IPMCNWKWK 541
>LOC_Os03g56370:12003.t04895:unspliced-genomic O-methyltransferase, putative, expressed| Length = 2621 Score = 24.4 bits (47), Expect(2) = 7.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +2 / -3 Query: 158 PRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPR 274 PR L P P+ R + P + + H P RPR Sbjct: 291 PRPGLLVAPHPLPERRQEPPPGEHPGRRVAHRAPPQRPR 175 Score = 23.5 bits (45), Expect(2) = 7.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 / -3 Query: 387 HPLPLFVHAREGDEPDTCQR 446 HPLPL + A D+ D +R Sbjct: 105 HPLPLLLAATAIDDDDLARR 46
>LOC_Os07g07990:12007.t00677:unspliced-genomic receptor protein kinase CLAVATA1 precursor, putative, expressed| Length = 1618 Score = 24.0 bits (46), Expect(3) = 7.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 / +1 Query: 230 PPKLLRHGLSPARPRDLGH*PYPPVDANR 316 PP+L R PA R + P PP A R Sbjct: 1054 PPELHRREARPAPGRPVPRLPPPPAGALR 1140 Score = 22.6 bits (43), Expect(3) = 7.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 / +1 Query: 140 PLLHFPPRVPLCRLPSPIASRNK 208 PLL PR P LP P A R + Sbjct: 430 PLLRRAPRHPPQALPPPRARRQQ 498 Score = 21.7 bits (41), Expect(3) = 7.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 / +3 Query: 3 PCSVSTKTAS 32 PCS ST TAS Sbjct: 408 PCSTSTPTAS 437
>LOC_Os04g02330:12004.t00127:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 2379 Score = 24.4 bits (47), Expect(2) = 7.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 / -2 Query: 142 PAPFPSKSPVMPPSIAN 192 P P P+ P PP+ AN Sbjct: 179 PFPLPTPPPCSPPTAAN 129 Score = 23.5 bits (45), Expect(2) = 7.8 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 / -3 Query: 247 PWFKPRSTSRSRALALPSSGCKPLP 321 PW P + R R A P+ PLP Sbjct: 124 PWGTPPTPPRERRGAPPTPPTPPLP 50
>LOC_Os11g36400:12011.t03187:unspliced-genomic expressed protein| Length = 2105 Score = 25.8 bits (50), Expect(2) = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 / +2 Query: 130 SSNTPAPFPSKSPVMPPS 183 S ++P P P + P PPS Sbjct: 296 SGSSPRPLPPRPPAAPPS 349 Score = 22.1 bits (42), Expect(2) = 7.9 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 / +2 Query: 179 LPSPIASRNKS*AEFPGP 232 LP P+ +R ++ + PGP Sbjct: 395 LPPPLPARRRTVLQAPGP 448
>LOC_Os02g02190:12002.t00119:unspliced-genomic high affinity nitrate transporter, putative, expressed| Length = 1860 Score = 29.5 bits (58), Expect(2) = 8.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 / +3 Query: 259 PRSTSRSRALALPSSGCKPLP 321 P +T +RA A PSS C P P Sbjct: 453 PSATCSARATAAPSSSCSPRP 515 Score = 21.7 bits (41), Expect(2) = 8.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 / +3 Query: 338 PGAENGAP*LPQSSLKPPTAS 400 PG+ + + P +S PPT S Sbjct: 936 PGSSSSSTATPWASSSPPTTS 998
>LOC_Os02g35800:12002.t03218:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2630 Score = 28.1 bits (55), Expect(2) = 8.1 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 / +2 Query: 517 YVFFSQICISIEDFSVN 567 Y +FS ICISI+ FS++ Sbjct: 1781 YSYFSYICISIKAFSIS 1831 Score = 23.5 bits (45), Expect(2) = 8.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 / +3 Query: 226 WSTEASPPWFKPRSTSRS 279 W +E F+PR+TSR+ Sbjct: 1410 WKSEGGARPFEPRATSRA 1463
>LOC_Os05g33920:12005.t02987:unspliced-genomic tetratricopeptide-like helical, putative, expressed| Length = 1257 Score = 24.9 bits (48), Expect(2) = 8.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 / +2 Query: 262 RSTSRSRALALPSSGCKP 315 RS+ RSRA A P + C P Sbjct: 98 RSSPRSRARAAPRTRCAP 151 Score = 23.1 bits (44), Expect(2) = 8.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 / +2 Query: 179 LPSPIASRNKS*AEFPGPP 235 L P ASRN+S P PP Sbjct: 17 LRRPAASRNRSACRRPPPP 73
>LOC_Os02g02170:12002.t00117:unspliced-genomic high affinity nitrate transporter, putative, expressed| Length = 1922 Score = 29.5 bits (58), Expect(2) = 8.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 / +2 Query: 259 PRSTSRSRALALPSSGCKPLP 321 P +T +RA A PSS C P P Sbjct: 458 PSATCSARATAAPSSSCSPRP 520 Score = 21.7 bits (41), Expect(2) = 8.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 / +2 Query: 338 PGAENGAP*LPQSSLKPPTAS 400 PG+ + + P +S PPT S Sbjct: 941 PGSSSSSTATPWASSSPPTTS 1003
>LOC_Os07g31370:12007.t02825:unspliced-genomic ras-related protein Rab-6A, putative, expressed| Length = 4013 Score = 30.9 bits (61), Expect = 8.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 / -2 Query: 144 CSISLQESRYAAFHRQLLPGINHEQNSLVHRSFS 245 CS+++ SRY F R+ +P + QN + H + + Sbjct: 1399 CSLTVLSSRYIVFDRKSIPIVACSQNRINHENIT 1298
>LOC_Os02g44980:12002.t04088:unspliced-genomic amino acid transport protein, putative, expressed| Length = 2154 Score = 30.9 bits (61), Expect = 8.4 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 / -3 Query: 338 AYQRDHGSGLHPLEGKANARDLEVERGLNHGGEASVD 228 A Q + HP G A LEVERG H E D Sbjct: 1444 AEQDEQDVAEHPGPGHLGAEHLEVERGRQHEAEQDAD 1334
>LOC_Os02g01960:12002.t00096:unspliced-genomic kinesin light chain, putative, expressed| Length = 3274 Score = 30.9 bits (61), Expect = 8.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 / -2 Query: 251 HGGEASVDQGILLMIYSWKQLAMEGGITGLLEGNGAGV 138 HGG+ V QG +++ K + + GLLE +G+ V Sbjct: 1176 HGGKHKVLQGTIIVTLGVKDECHQAAVGGLLERSGSAV 1063
>LOC_Os12g15670:12012.t01422:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7687 Score = 30.9 bits (61), Expect = 8.5 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +1 / +2 Query: 301 SGCKPLP*SRWYARCREWSPLATAIFVEATHCLCSCTRGKEMN 429 +GC P R W LA + HC+C C+R + N Sbjct: 437 AGCLAAPDDLLPRRRAGWKELARRHTRKGIHCMCMCSRPPDQN 565
>LOC_Os10g27300:12010.t003615:unspliced-genomic expressed protein| Length = 4157 Score = 30.9 bits (61), Expect = 8.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +2 / +2 Query: 143 LLHFPPRVPLCRLPSPIASRNKS*AEFPGP 232 +LH PPRV CR SP ++ + AE P P Sbjct: 338 VLHAPPRVYCCRRRSPGLPQSVAGAEAPPP 427
>LOC_Os10g11150:12010.t00916:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1440 Score = 30.9 bits (61), Expect = 8.5 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 / +2 Query: 154 PSKSPVMPPSIANCFQE*IMSRIPWSTEASPP 249 P+ P +PPS A+ + ++ R W++ SPP Sbjct: 299 PTGLPALPPSGASAYTAGLLCRRCWASTTSPP 394
>LOC_Os08g36910:12008.t03430:unspliced-genomic alpha-amylase isozyme 3D precursor, putative, expressed| Length = 2858 Score = 30.9 bits (61), Expect = 8.5 Identities = 19/64 (29%), Positives = 25/64 (39%) Frame = +1 / -2 Query: 223 PWSTEASPPWFKPRSTSRSRALALPSSGCKPLP*SRWYARCREWSPLATAIFVEATHCLC 402 P A PW+ R++S +R PSS P W CR A++I C Sbjct: 1738 PGRPPAGGPWW*SRTSSPARRRRSPSSPAPAGPGPGWPPACRRRCSSASSISRRRRSPAC 1559 Query: 403 SCTR 414 S R Sbjct: 1558 SSRR 1547
>LOC_Os08g33076:12008.t03051:unspliced-genomic myrosinase precursor, putative, expressed| Length = 4788 Score = 30.9 bits (61), Expect = 8.5 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 / -1 Query: 230 PPKLLRHGLSPARPRDLGH*PYPPVDANRFRDHAGMPGAENG 355 PP + H PR P+PP+ + AG+PG E G Sbjct: 273 PPPQVEHAQLRPLPRRRRREPHPPLPPSHATCLAGVPGREEG 148
>LOC_Os08g15190:12008.t01393:unspliced-genomic expressed protein| Length = 1879 Score = 30.9 bits (61), Expect = 8.5 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +1 / -3 Query: 145 APFPSKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKPRSTSRSRALALPSSGCK 312 +P P +SP P I + IP + +S P + SR R A P++ C+ Sbjct: 1373 SPLPGRSPPPPRPIKRSPDPLLSPHIPQPSPSSLPGCRAAFFSRRRRRATPAAPCR 1206
>LOC_Os07g11670:12007.t01040:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5856 Score = 30.9 bits (61), Expect = 8.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 / -1 Query: 103 AKFEIGRADSSNTPAPFPSKSPVMPPS 183 +K ++ R+ + TP PFP+ SP P S Sbjct: 1497 SKVQLPRSSFAATPVPFPATSPSFPSS 1417
>LOC_Os06g49220:12006.t04606:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 2444 Score = 30.9 bits (61), Expect = 8.5 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 / -3 Query: 226 WSTEASPPWFKPRSTSRSRALALPSSGCKPLP*SRWYARCREWSPLATA 372 WS+ + PP ++ R+ + + GC+ P +RW R P TA Sbjct: 1971 WSSGSPPPRWRRARAPRTPSSWRAAPGCRRSPAARWR*AARRRPPARTA 1825
>LOC_Os05g48260:12005.t04260:unspliced-genomic expressed protein| Length = 4273 Score = 30.9 bits (61), Expect = 8.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / -1 Query: 139 TPAPFPSKSPVMPPSIANC 195 TP P PS+SP PP A C Sbjct: 379 TPPPMPSRSPPPPPPAAPC 323
>LOC_Os04g59190:12004.t05377:unspliced-genomic peroxidase 2 precursor, putative, expressed| Length = 1610 Score = 30.9 bits (61), Expect = 8.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 / +1 Query: 32 PNPQLSRLWSPCPPTVKLTATTVR 103 P P SR W+ PP+ TATT R Sbjct: 991 PTPTRSRTWTSSPPSPSTTATT*R 1062
>LOC_Os04g58330:12004.t05296:unspliced-genomic expressed protein| Length = 3386 Score = 30.9 bits (61), Expect = 8.5 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 / -3 Query: 229 STEASPPWFKPRSTSRSRALALPSSGCKPLP 321 S SPPW +P S + L SS C P P Sbjct: 261 SAPPSPPWPRPTRVSHHQLRLLLSSVCTPTP 169
>LOC_Os04g53730:12004.t04847:unspliced-genomic expressed protein| Length = 748 Score = 30.9 bits (61), Expect = 8.5 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 / +2 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSPARPRD 277 P +P+ RLP+P R + P P L R + RP D Sbjct: 395 PAGLPVARLPAPAGLRRRRRRRRPSPGHLRRRRHAARRPAD 517
>LOC_Os04g48410:12004.t04358:unspliced-genomic copper chaperone for superoxide dismutase, putative, expressed| Length = 4497 Score = 30.9 bits (61), Expect = 8.5 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPK 238 PPR PL R P+P ASR P PP+ Sbjct: 275 PPRTPLPRPPAPPASRTPCLRWPPPPPR 358
>LOC_Os04g31140:12004.t02799:unspliced-genomic expressed protein| Length = 2299 Score = 30.9 bits (61), Expect = 8.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 / +3 Query: 115 IGRADSSNTPAPFPSKSPVMPPSIANCF 198 +GR+ + TP+ PS SP+ PPS A F Sbjct: 144 LGRSRAMATPSRCPSCSPIHPPSPAALF 227
>LOC_Os02g58330:12002.t05404:unspliced-genomic pentatricopeptide repeat protein PPR868-14, putative, expressed| Length = 2148 Score = 30.9 bits (61), Expect = 8.5 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 / +3 Query: 130 SSNTPAPFPSKSPVMPPSI 186 SS TP P PS SP PPS+ Sbjct: 252 SSPTPTPSPSSSPPPPPSL 308
>LOC_Os02g57010:12002.t05273:unspliced-genomic ribonucleoprotein, chloroplast, putative, expressed| Length = 2306 Score = 30.9 bits (61), Expect = 8.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 / +1 Query: 223 PWSTEASPPWFKPRSTSRSRALALPSSGC 309 PW T A+PP PR SR+ + P C Sbjct: 40 PWPTPAAPPPLPPRYASRAPSSRTPP*SC 126
>LOC_Os02g51650:12002.t04746:unspliced-genomic hypothetical protein| Length = 1990 Score = 30.9 bits (61), Expect = 8.5 Identities = 18/59 (30%), Positives = 23/59 (38%) Frame = +1 / -3 Query: 85 HCHHGQAKFEIGRADSSNTPAPFPSKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKP 261 H H K I RA P S++P PS+ C I +P T A P+ P Sbjct: 338 HFHKTPPKHHIHRAPEPQPPLVTSSRAPPPLPSLPRCATTAIGIAVPRRTPAPTPFPLP 162
>LOC_Os02g35020:12002.t03140:unspliced-genomic secondary cell wall-related glycosyltransferase family 8, putative,| expressed Length = 3505 Score = 30.9 bits (61), Expect = 8.5 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 / -3 Query: 158 PRVPLCRLPSPIASRNKS*AEFPGPPKLLRHGLSP 262 PR P CR P+P A R + + PP R +P Sbjct: 2273 PRAPPCRAPAPTAPRRRRPSGCSAPPLARRTRTAP 2169
>LOC_Os02g16709:12002.t01463:unspliced-genomic signal peptidase I-1, putative, expressed| Length = 6457 Score = 30.9 bits (61), Expect = 8.5 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 / -2 Query: 82 THCHHGQAKFEIGRADSSNTPAPFPSKSPVMPP 180 T H G + F + + SS+ P P PS P PP Sbjct: 462 TLSHSGSSPFLVPSSSSSSPPPPPPSPPPPPPP 364
>LOC_Os02g15830:12002.t01376:unspliced-genomic hypothetical protein| Length = 390 Score = 30.9 bits (61), Expect = 8.5 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +1 / -1 Query: 61 AVSAYGETHCHHGQAKFEIGRADSSNTPAPFPSKSPVMPPSIAN 192 A +A C + F A ++P P P+ SP PP++A+ Sbjct: 276 AAAATTPPPCSPRRLSFSTSTAAVRSSPPPLPTASPAPPPALAS 145
>LOC_Os01g52250:12001.t04652:unspliced-genomic glycogen synthase, putative, expressed| Length = 10480 Score = 30.9 bits (61), Expect = 8.5 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 155 PPRVPLCRLPSPIASRNKS*AEFPGPPKLLRHG 253 PPR P R PSP+ S + FPG + R G Sbjct: 77 PPRPPPFRTPSPLPRAPASASAFPGRRRRRRRG 175
>LOC_Os01g33000:12001.t02870:unspliced-genomic expressed protein| Length = 3966 Score = 30.9 bits (61), Expect = 8.5 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +1 / +2 Query: 130 SSNTPAPFPSKSPVMPPSIANCFQE*IMSRIPWSTEASPPWFKP 261 ++ P+P P+++PV PP +A + + + P+ P +P Sbjct: 356 AAEEPSPSPARAPVPPPGVAGNLERFVAAVTPFVPAQFPSKVRP 487
>LOC_Os08g21180:12008.t01916:unspliced-genomic conserved hypothetical protein| Length = 813 Score = 25.4 bits (49), Expect(2) = 8.5 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 / -2 Query: 257 SPARPRDLGH*PYPPVDANRFRDHAGMPG 343 +P PR+ P P R RD + MPG Sbjct: 203 TPPPPRESSPPPGPRCRRRRHRDSSSMPG 117 Score = 22.6 bits (43), Expect(2) = 8.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 / -2 Query: 127 DSSNTPAPFPSKSP 168 DSS+TP P P P Sbjct: 311 DSSSTPGPAPPPPP 270
>LOC_Os03g20350:12003.t01794:unspliced-genomic conserved hypothetical protein| Length = 1425 Score = 25.4 bits (49), Expect(2) = 8.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 / +1 Query: 130 SSNTPAPFPSKSPVMPPSIA 189 ++ TP P P++ P PP A Sbjct: 433 AATTPRPLPTRPPPPPPETA 492 Score = 25.4 bits (49), Expect(2) = 8.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +2 / +1 Query: 182 PSPIASRNKS*AEFPGPPKLLRHGLSPARPRDLGH*PYPPVDANR 316 PSP + +S +P P +L SP P P +DA+R Sbjct: 694 PSPTPQKPRSEEHYPSPDSVLDAITSPRFPCRKRSSPCTDLDADR 828
>LOC_Os03g58270:12003.t05087:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4068 Score = 28.1 bits (55), Expect(2) = 8.8 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 / +2 Query: 208 IMSRIPWSTEASPPWFKPRSTSRSRALALPSSGCKPLP 321 I+ I S+E WF TSRSR + +S +PLP Sbjct: 3377 ILLAIAASSEVCGTWFTQDWTSRSRWVMSVASWRRPLP 3490 Score = 24.0 bits (46), Expect(2) = 8.8 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 / +2 Query: 55 VVAVSAYGETHCHHGQAKFEIGRADSSNTPAPFPSKSPVMPPS 183 V +VSA G+ KF + S P+P + SP P+ Sbjct: 959 VPSVSATAPLSASKGEVKF*LCATMESTVPSPKSTSSPS*TPT 1087
>LOC_Os04g20540:12004.t01791:unspliced-genomic hydroquinone glucosyltransferase, putative, expressed| Length = 1477 Score = 27.2 bits (53), Expect(2) = 8.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 / -3 Query: 250 WFKPRSTSRSRALALPSSGCKPLP*SRWYAR 342 W + R T+R A A PSS + +RW R Sbjct: 881 WCRTRCTARIPAAACPSSAARCRRWARWLRR 789 Score = 23.5 bits (45), Expect(2) = 8.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 / -1 Query: 192 LLPGINHEQNSLVH 233 LLPGI+H + L+H Sbjct: 1417 LLPGIHHHRPHLLH 1376
>LOC_Os01g36860:12001.t03235:unspliced-genomic ATP-dependent RNA helicase-like protein DB10, putative, expressed| Length = 5797 Score = 29.0 bits (57), Expect(2) = 8.9 Identities = 20/67 (29%), Positives = 25/67 (37%) Frame = +2 / +3 Query: 254 LSPARPRDLGH*PYPPVDANRFRDHAGMPGAENGAP*LPQSSLKPPTASVRAREGRR*TR 433 L P RPR P P R PG + PP++S R R RR*+ Sbjct: 315 LRPRRPRPRPPRPLPIPHPAAARPPGPRPGPRQAPRRPQVGAFPPPSSSGRRRHRRR*SL 494 Query: 434 YLSASHP 454 + S P Sbjct: 495 HRGVSPP 515 Score = 23.5 bits (45), Expect(2) = 8.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 / +1 Query: 130 SSNTPAPFPSKSPVMPP 180 + P P PS SP PP Sbjct: 7 TEENPKPSPSPSPAPPP 57
>LOC_Os02g55400:12002.t05116:unspliced-genomic ATPase 8, plasma membrane-type, putative, expressed| Length = 4363 Score = 29.5 bits (58), Expect(2) = 9.2 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 / +1 Query: 214 SRIPWSTEASPPWFKPRSTSRSRALALPSSGCKP 315 S P +T +PP + S SRSR A S+ C P Sbjct: 1864 SASPSTTPRTPPGARRTSCSRSRGSASSSAPCSP 1965 Score = 22.6 bits (43), Expect(2) = 9.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 / +2 Query: 393 LPLFVHAREGDEPDTCQRATLS 458 LP FV +G PDT A LS Sbjct: 4151 LPFFVFC*QGIVPDTTGGALLS 4216
>LOC_Os05g39720:12005.t03513:unspliced-genomic OsWRKY70 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2976 Score = 24.0 bits (46), Expect(3) = 9.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 / -1 Query: 331 WYARCREWSPLATA 372 W+A CR SP A A Sbjct: 2244 WWASCRRCSPAAAA 2203 Score = 23.5 bits (45), Expect(3) = 9.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 / -1 Query: 215 AEFPGPPKLLRHGLSPAR 268 A +PGPPK ++ P R Sbjct: 2667 AAWPGPPKQMKQSHKPYR 2614 Score = 22.1 bits (42), Expect(3) = 9.2 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 / -1 Query: 247 PWFKPRSTSRSRALALPSS 303 PW RST R A A S Sbjct: 2472 PWLSTRSTPRRSAAAAAGS 2416
>LOC_Os03g18060:12003.t01580:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 8941 Score = 29.5 bits (58), Expect(2) = 9.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 / -3 Query: 390 PLPLFVHAREGDEPDTCQRATLSRQ*RTAVGR 485 P PL R+ DEP T R+++ + R +GR Sbjct: 6083 PFPLPCGMRDDDEPPTSSRSSILMECRAVLGR 5988 Score = 23.5 bits (45), Expect(2) = 9.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 / -2 Query: 223 PWSTEASPPWFKPRSTS 273 P S A+P W PRS S Sbjct: 6774 PPSLTAAPGWLAPRSAS 6724 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 276,829,698 Number of extensions: 5442920 Number of successful extensions: 36641 Number of sequences better than 10.0: 192 Length of query: 203 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 155 Effective length of database: 52,912,542 Effective search space: 8201444010 Effective search space used: 8201444010 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)