| Clone Name | FLbaf90n18 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os08g21460:12008.t01940:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3831 Score = 34.1 bits (68), Expect = 0.80 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 / -3 Query: 523 HMYRLNHRRFYLGVYTCMAWHPLCSCRQLV 434 H+ R NH F Y C+ H SCR L+ Sbjct: 2614 HVNRCNHNSFPFSQYFCLIGHGFISCRNLI 2525
>LOC_Os02g14770:12002.t01271:unspliced-genomic phosphoenolpyruvate carboxylase 1, putative, expressed| Length = 11795 Score = 33.6 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 / +3 Query: 9 PASRKHTGSS*PIPIKASNPNPKQPRRC 92 PA R+ T SS P P + + +P PRRC Sbjct: 579 PACRRGTPSSSPAPSRTCSTSPTSPRRC 662
>LOC_Os02g02770:12002.t00176:unspliced-genomic pentatricopeptide, putative, expressed| Length = 2526 Score = 33.6 bits (67), Expect = 1.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 / +2 Query: 12 ASRKHTGSS*PIPIKASNPNPKQPRRC 92 A+R++ S P P +AS P P PRRC Sbjct: 524 AARRNQDPSSPTPSRASTPPPPPPRRC 604
>LOC_Os11g04930:12011.t00386:unspliced-genomic SPRY domain containing protein, expressed| Length = 3358 Score = 33.1 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 / +3 Query: 520 MYRLNHRRFYLGVYTCMAWHPLCSCRQLVFTYI 422 ++ L HRR LGV+T A + SCR+ + Y+ Sbjct: 2097 IFLLYHRRLLLGVFTYPAIIAILSCRRFHYVYV 2195
>LOC_Os09g04200:12009.t00316:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2456 Score = 33.1 bits (66), Expect = 1.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 / -2 Query: 529 HKHMYRLNHRRFYLGVYTC 473 H HMY L H FY+ +Y C Sbjct: 1174 HTHMYNLKHLTFYVHIYIC 1118
>LOC_Os01g69970:12001.t06299:unspliced-genomic periodic tryptophan protein 1, putative, expressed| Length = 4751 Score = 32.7 bits (65), Expect = 2.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 / -1 Query: 480 IHAWHGTRSAHAGSWCLHTYKDP*SCS 400 IHA H +SA SWC + ++ P S S Sbjct: 1292 IHAVHNGKSARGTSWCTNIFRSPSSVS 1212
>LOC_Os04g39060:12004.t03476:unspliced-genomic CRS1 / YhbY domain containing protein, expressed| Length = 5943 Score = 32.2 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 / +3 Query: 340 MHAPCVHDIYDRPIHILPCNAT*SRVFVCM 429 M PC + + R + CN T SRVF+C+ Sbjct: 3396 MAVPCAYCLAPRETLLSDCNITTSRVFICL 3485
>LOC_Os01g74300:12001.t06709:unspliced-genomic metallothionein-like protein type 2, putative, expressed| Length = 1007 Score = 31.8 bits (63), Expect = 3.9 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 / -1 Query: 294 VPHLHWVQPQPPFSAAIS 241 VPHL +QPQ PFSA IS Sbjct: 683 VPHLQVLQPQLPFSAPIS 630
>LOC_Os12g18220:12012.t01672:unspliced-genomic thioredoxin family protein| Length = 1124 Score = 31.3 bits (62), Expect = 5.4 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 / -3 Query: 523 HMYRLNHRRFYLGVYTCMAWHPLCSCRQLVFTYIQ 419 H+Y N RR Y+ Y + HP+C+ ++YI+ Sbjct: 714 HVYTDNFRRTYVMPYDHIVDHPVCTVCPRTYSYIR 610
>LOC_Os07g17840:12007.t01643:unspliced-genomic conserved hypothetical protein| Length = 6361 Score = 31.3 bits (62), Expect = 5.4 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 / -3 Query: 415 VFVCM*TPAACMSRAGAMPCMYKPLNKIFCGLTYTC 522 +++C+*T C+ G +YK +F GL Y C Sbjct: 716 LYMCI*TLYTCIFLVGIRMHVYKVCKHVFFGLLYVC 609
>LOC_Os07g10110:12007.t00885:unspliced-genomic expressed protein| Length = 7805 Score = 31.3 bits (62), Expect = 5.4 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 / +2 Query: 523 HMYRLNHRRFYLGVYTCMAWHPLCSCRQLVFTYIQ 419 H+Y N RR Y+ Y + HP+C+ ++YI+ Sbjct: 6221 HVYTDNFRRTYVMSYDHIVDHPVCTVCPRTYSYIR 6325
>LOC_Os05g02070:12005.t00106:unspliced-genomic metallothionein-like protein type 2, putative, expressed| Length = 1112 Score = 31.3 bits (62), Expect = 5.4 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 / -1 Query: 294 VPHLHWVQPQPPFS 253 VPHL +QPQPPFS Sbjct: 650 VPHLQVLQPQPPFS 609
>LOC_Os10g30054:12010.t02340:unspliced-genomic ENT domain containing protein, expressed| Length = 9476 Score = 30.9 bits (61), Expect = 7.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 / +1 Query: 56 FDWYWLGASCVLPACWL 6 F ++W+ A C+ P CWL Sbjct: 1114 FFFFWVSAECLQPLCWL 1164
>LOC_Os05g24900:12005.t02147:unspliced-genomic expressed protein| Length = 2054 Score = 30.9 bits (61), Expect = 7.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 / +3 Query: 101 RSKTSSRLLGIGVRGFDWYWLGASCVLPACW 9 RS TSSR + +R W W A+ LP+ W Sbjct: 606 RSATSSRTVR*PMRVRPWAWTSAAASLPSSW 698
>LOC_Os03g19420:12003.t01708:unspliced-genomic nicotianamine synthase 2, putative, expressed| Length = 1476 Score = 30.9 bits (61), Expect = 7.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 / +1 Query: 435 TSCLHEQSGCHAMHV*TPK*NLLWFNLYMCLC 530 + C+H GC ++ V + *N++ L +C C Sbjct: 1087 SECVHSNPGCVSLSVTSAG*NIIGIGLCLCFC 1182
>LOC_Os02g15920:12002.t01385:unspliced-genomic conserved hypothetical protein| Length = 4865 Score = 30.9 bits (61), Expect = 7.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 / -2 Query: 6 KPASRKHTGSS*PIPIKASNPNPKQPR 86 +PA+R H SS P+P + +P+ PR Sbjct: 3814 RPANRGHPASSSPVPSRPRHPSELHPR 3734
>LOC_Os09g11320:12009.t00922:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4483 Score = 30.9 bits (61), Expect = 7.4 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 / +2 Query: 523 HMYRLNHRRFYLGVYTCMAWHPLCSCRQLVFTYIQ 419 H+Y N RR Y+ Y + HP+C+ ++YI+ Sbjct: 2237 HVYTDNFRRTYVMPYDHIVDHPVCTVCPHTYSYIR 2341 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 165,663,927 Number of extensions: 2365003 Number of successful extensions: 8750 Number of sequences better than 10.0: 17 Length of query: 183 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 135 Effective length of database: 52,912,542 Effective search space: 7143193170 Effective search space used: 7143193170 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)