| Clone Name | FLbaf92h18 |
|---|---|
| Clone Library Name | barley_pub |
>Q91YR5:K0859_MOUSE Uncharacterized protein KIAA0859 - Mus musculus (Mouse)| Length = 698 Score = 39.7 bits (91), Expect = 0.016 Identities = 13/50 (26%), Positives = 28/50 (56%) Frame = +3 Query: 207 YGEARYWDARYMEEGGAPYDCYQRYAALRPFVRRFVPPAYRLFIIGCGSA 356 +G A YW+ + + G ++ Y Y L + +++ P ++ +IGCG++ Sbjct: 11 FGSADYWEKFFQQRGKTAFEWYGTYLELCEVLHKYIKPKEKVLVIGCGNS 60
>Q8N6R0:K0859_HUMAN Uncharacterized protein KIAA0859 - Homo sapiens (Human)| Length = 699 Score = 37.4 bits (85), Expect = 0.079 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = +3 Query: 207 YGEARYWDARYMEEGGAPYDCYQRYAALRPFVRRFVPPAYRLFIIGCGSA 356 +G YW+ + + G ++ Y Y L + +++ P ++ +IGCG++ Sbjct: 11 FGSVDYWEKFFQQRGKKAFEWYGTYLELCGVLHKYIKPREKVLVIGCGNS 60
>Q96N68:CR015_HUMAN Uncharacterized protein C18orf15 - Homo sapiens (Human)| Length = 181 Score = 33.1 bits (74), Expect = 1.5 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +2 Query: 677 LCICWVLFLCTCTCRSILLCTCKIILMCPC 766 +C+C + +C C + +C C ++ MC C Sbjct: 127 VCMCACMCVCVHVCACVYVCMCVLVCMCAC 156
>O87005:CHPE_PSEAE Chemotactic transduction protein chpE - Pseudomonas aeruginosa| Length = 203 Score = 30.8 bits (68), Expect = 7.4 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +3 Query: 129 SWSPPLPPRGAEEEGDTRSGGGAVFSYGEAR---YWDA 233 +WSPPL A E+G G GA S + YW A Sbjct: 92 AWSPPLAAEDAGEQGRNAFGAGAAISLSNPKNVVYWGA 129
>Q9STN3:SPT51_ARATH Putative transcription elongation factor SPT5 homolog 1 -| Arabidopsis thaliana (Mouse-ear cress) Length = 1054 Score = 30.4 bits (67), Expect = 9.7 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 81 PAHFLARAPCRPRAMSSWSPPLPPRGAEEEGDTRSGG 191 P H R P R RA + ++P PPR E+G+ S G Sbjct: 814 PIHDGMRTPMRDRAWNPYTPMSPPRDNWEDGNPGSWG 850
>Q02722:Q300_MOUSE Protein Q300 - Mus musculus (Mouse)| Length = 77 Score = 30.4 bits (67), Expect = 9.7 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 659 NSLYVRLCICWVLFLCTCTCRSILLCTCK 745 N YV +C+C +C C C L C CK Sbjct: 23 NLFYVCVCVC----VCVCVCVCTLTCMCK 47 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 130,417,096 Number of extensions: 2783445 Number of successful extensions: 8429 Number of sequences better than 10.0: 6 Number of HSP's gapped: 8413 Number of HSP's successfully gapped: 6 Length of query: 290 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 178 Effective length of database: 69,965,399 Effective search space: 12453841022 Effective search space used: 12453841022 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)