Clone Name | FLbaf92h05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | P23920:SYM_BACST Methionyl-tRNA synthetase - Bacillus stearother... | 33 | 6.2 | 2 | O70218:HMX1_MOUSE Homeobox protein HMX1 - Mus musculus (Mouse) | 32 | 8.1 |
---|
>P23920:SYM_BACST Methionyl-tRNA synthetase - Bacillus stearothermophilus (Geobacillus| stearothermophilus) Length = 649 Score = 32.7 bits (73), Expect = 6.2 Identities = 23/98 (23%), Positives = 48/98 (48%) Frame = +2 Query: 1157 YGTLNDNNDQYSGMIIFPRINIDADKFDYASKMLETIRALIKRLEKIDPTKMAHEEQLCF 1336 +G + + + G +FPR++I + +E I+A ++ + + K + Sbjct: 492 FGLIPEGTNVQKGEPLFPRLDIGVE--------VEYIKAHMQGGKPAEAAKEEKQAARAE 543 Query: 1337 WINIHNALVMHAFMAYGLQDKRMKSSDMILKAAYDVGG 1450 I+I + + +A +Q +RMK++D +LK D+GG Sbjct: 544 EISIDDFAKVDLRVAEVVQPERMKNADKLLKLQLDLGG 581
>O70218:HMX1_MOUSE Homeobox protein HMX1 - Mus musculus (Mouse)| Length = 332 Score = 32.3 bits (72), Expect = 8.1 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = -1 Query: 770 LDGAFLDPPDQKHEGRYPGIDQTSPCRAKANAVPFVRLPPQGPLSPKPIL 621 L+ A L PP + R P + SP A A+PF PP P P P+L Sbjct: 254 LEAASLSPPGAQRLVRVPVLYHESPPAAAGPALPFPLAPP-APAPPPPLL 302 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 356,636,693 Number of extensions: 7630702 Number of successful extensions: 19562 Number of sequences better than 10.0: 2 Number of HSP's gapped: 19553 Number of HSP's successfully gapped: 2 Length of query: 706 Length of database: 100,686,439 Length adjustment: 120 Effective length of query: 586 Effective length of database: 67,771,039 Effective search space: 39713828854 Effective search space used: 39713828854 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)