Clone Name | FLbaf92d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Q7TT36:GP125_MOUSE Probable G-protein coupled receptor 125 precu... | 33 | 6.0 | 2 | Q8IWK6:GP125_HUMAN Probable G-protein coupled receptor 125 precu... | 33 | 7.9 |
---|
>Q7TT36:GP125_MOUSE Probable G-protein coupled receptor 125 precursor - Mus musculus| (Mouse) Length = 1310 Score = 33.1 bits (74), Expect = 6.0 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 12/66 (18%) Frame = -3 Query: 766 TIITTNRNAWVLLVSYCDKLT------------TKSTSTCEILKIIMHYPTRAVLVYCRI 623 ++I + +W +LV+ C + T++ S C+ + II+HY T A +++ + Sbjct: 775 SLIRISLKSWHMLVNLCFHILLTCVVFVGGITQTRNASVCQAVGIILHYSTLATVLWVGV 834 Query: 622 GVYNVY 605 N+Y Sbjct: 835 TARNIY 840
>Q8IWK6:GP125_HUMAN Probable G-protein coupled receptor 125 precursor - Homo sapiens| (Human) Length = 1321 Score = 32.7 bits (73), Expect = 7.9 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 12/66 (18%) Frame = -3 Query: 766 TIITTNRNAWVLLVSYCDKL------------TTKSTSTCEILKIIMHYPTRAVLVYCRI 623 ++I + +W +LV+ C + T++ S C+ + II+HY T A +++ + Sbjct: 786 SLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASICQAVGIILHYSTLATVLWVGV 845 Query: 622 GVYNVY 605 N+Y Sbjct: 846 TARNIY 851 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 459,622,627 Number of extensions: 10285178 Number of successful extensions: 21316 Number of sequences better than 10.0: 2 Number of HSP's gapped: 21301 Number of HSP's successfully gapped: 2 Length of query: 872 Length of database: 100,686,439 Length adjustment: 122 Effective length of query: 750 Effective length of database: 67,222,449 Effective search space: 50416836750 Effective search space used: 50416836750 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)