Clone Name | FLbaf9l05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Q8BH65:F116A_MOUSE Protein FAM116A - Mus musculus (Mouse) | 34 | 2.6 | 2 | Q6PIJ4:NFRKB_MOUSE Nuclear factor related to kappa-B-binding pro... | 33 | 5.8 |
---|
>Q8BH65:F116A_MOUSE Protein FAM116A - Mus musculus (Mouse)| Length = 605 Score = 33.9 bits (76), Expect = 2.6 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +1 Query: 661 LNGPKLFGSGKRTSLD--GGSGRRAARSVLTLVMLEDDMPREG 783 L GP +FG G R SLD G GR AA V LED+ +G Sbjct: 3 LPGPAVFGPGSRGSLDEAGAEGREAAALAAAGVALEDEEEDDG 45
>Q6PIJ4:NFRKB_MOUSE Nuclear factor related to kappa-B-binding protein - Mus musculus| (Mouse) Length = 1296 Score = 32.7 bits (73), Expect = 5.8 Identities = 24/87 (27%), Positives = 33/87 (37%) Frame = +1 Query: 169 FRVGLRSSWTTRLVDSGRSKLVDLLKTLRISKVLESRTSLTNQLEGSSQFFAEDLGLILE 348 F V S+W L DS R L L V + R + G + F L + + Sbjct: 50 FDVVSLSTWQEVLSDSQREHLQQFLPRFPADSVEQQRELILALFSGENFRFGNPLHIAQK 109 Query: 349 TLTVSCMIPDVQVYRTACYTSQFCRLL 429 P+V YR C+ SQ+ R L Sbjct: 110 LFRDGHFNPEVVKYRQLCFKSQYKRYL 136 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 348,595,703 Number of extensions: 7738642 Number of successful extensions: 18838 Number of sequences better than 10.0: 2 Number of HSP's gapped: 18832 Number of HSP's successfully gapped: 2 Length of query: 668 Length of database: 100,686,439 Length adjustment: 120 Effective length of query: 548 Effective length of database: 67,771,039 Effective search space: 37138529372 Effective search space used: 37138529372 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)