Clone Name | FLbaf8h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | P46531:NOTC1_HUMAN Neurogenic locus notch homolog protein 1 prec... | 29 | 8.1 |
---|
>P46531:NOTC1_HUMAN Neurogenic locus notch homolog protein 1 precursor - Homo sapiens| (Human) Length = 2556 Score = 29.3 bits (64), Expect = 8.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 173 ALNPQVCPKRPSCATPGASYTNGPKCIYHNREAVC 277 AL P + + P C+ PG + NG KC N C Sbjct: 12 ALLPALAARGPRCSQPGETCLNGGKCEAANGTEAC 46 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 94,591,239 Number of extensions: 2167123 Number of successful extensions: 4637 Number of sequences better than 10.0: 1 Number of HSP's gapped: 4636 Number of HSP's successfully gapped: 1 Length of query: 171 Length of database: 100,686,439 Length adjustment: 105 Effective length of query: 66 Effective length of database: 71,885,464 Effective search space: 4744440624 Effective search space used: 4744440624 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)