Clone Name | rbastl56g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PQQD_SILPO (Q5LTB3) Coenzyme PQQ synthesis protein D (Pyrroloqui... | 31 | 1.0 | 2 | EXPI_PECCC (P33882) Autoinducer synthesis protein expI | 28 | 6.6 | 3 | SETD8_DROME (Q9VFK6) Histone-lysine N-methyltransferase, H4 lysi... | 28 | 8.6 |
---|
>PQQD_SILPO (Q5LTB3) Coenzyme PQQ synthesis protein D (Pyrroloquinoline quinone| biosynthesis protein D) Length = 95 Score = 30.8 bits (68), Expect = 1.0 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 122 RPFLPRGRRLIIDRDTGGFV 63 RP+LPRG RL+ DR GG V Sbjct: 10 RPYLPRGVRLVTDRVRGGIV 29
>EXPI_PECCC (P33882) Autoinducer synthesis protein expI| Length = 217 Score = 28.1 bits (61), Expect = 6.6 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +2 Query: 35 ETRYSSTLHGQNPPYHDR*LIVFRAVKMDVPQNHHISSPTFFSNEMKAK 181 ET+Y + + G PY + K+D+P+ +I S FF ++ ++K Sbjct: 71 ETKYPNMITGTFFPYFE---------KIDIPEGKYIESSRFFVDKARSK 110
>SETD8_DROME (Q9VFK6) Histone-lysine N-methyltransferase, H4 lysine-20 specific| (EC 2.1.1.43) (Histone H4-K20 methyltransferase) (H4-K20-HMTase) (dSET8) Length = 691 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 155 MLDWKCDGFEGRPFLPRGRRLIIDR 81 +L+ +CDG + R F+ +GR ++ DR Sbjct: 549 VLEERCDGLQVRHFMGKGRGVVADR 573 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,830,534 Number of Sequences: 219361 Number of extensions: 463114 Number of successful extensions: 959 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)