ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl56g04 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC1_HUMAN (P46531) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| (hN1) (Translocation-associated notch protein TAN-1) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2556 Score = 32.0 bits (71), Expect = 0.37 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 371 PHCQHILHWLDGGRSEGFGGCFQEH 297 P+CQ+++HW D + G C+Q H Sbjct: 1055 PNCQNLVHWCDSSPCKNGGKCWQTH 1079
>METE_MESCR (P93263) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Vitamin-B12-independent methionine synthase isozyme) (Cobalamin-independent methionine synthase isozyme) Length = 765 Score = 30.0 bits (66), Expect = 1.4 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = -1 Query: 346 GWTAAEVKASEDAFKSMAEANPSRPILKMTR---LNPQYMLREEQIDMAGSGTTNKFVLL 176 GWT E++ D + SMA N S P ++MT+ N +++ E ++ S ++K VL Sbjct: 83 GWTGGEIEF--DVYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPEVNFSYASHKAVLE 140 Query: 175 Y 173 Y Sbjct: 141 Y 141
>GLHA_MACMU (P22762) Glycoprotein hormones alpha chain precursor (Anterior| pituitary glycoprotein hormones common alpha subunit) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain) (Luteinizing hormone a Length = 120 Score = 28.5 bits (62), Expect = 4.1 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = -3 Query: 200 YY*QVCTFVLVSSRSKDVHMLHSFSGNPFQLERKP*SLRCLNRDAPLVMEPKS---LCCG 30 YY + +LV+ S +H+LHSF F ++ P C R+ +P + C G Sbjct: 3 YYRKYAAVILVTL-SVFLHILHSFPDGEFTMQDCP---ECKPRENKFFSKPGAPIYQCMG 58 Query: 29 CC 24 CC Sbjct: 59 CC 60
>GLHA_MACFA (Q9BEH3) Glycoprotein hormones alpha chain precursor (Anterior| pituitary glycoprotein hormones common alpha subunit) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain) (Luteinizing hormone a Length = 120 Score = 28.5 bits (62), Expect = 4.1 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = -3 Query: 200 YY*QVCTFVLVSSRSKDVHMLHSFSGNPFQLERKP*SLRCLNRDAPLVMEPKS---LCCG 30 YY + +LV+ S +H+LHSF F ++ P C R+ +P + C G Sbjct: 3 YYRKYAAVILVTL-SVFLHILHSFPDGEFTMQDCP---ECKPRENKFFSKPGAPIYQCMG 58 Query: 29 CC 24 CC Sbjct: 59 CC 60
>P100_HCMVA (P08318) Large structural phosphoprotein (pp150) (150 kDa matrix| phosphoprotein) (Basic phosphoprotein) (BPP) (Tegument protein UL32) Length = 1048 Score = 28.1 bits (61), Expect = 5.4 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +3 Query: 192 LVVPEPAIS-ICSSRNIYCGLSLVIFSIGRLGFASAMLLKASSEAFTSAAVQPMQYM 359 L+ P+PA S SSRN+ G S R ASA +L + + S A P+ + Sbjct: 818 LLQPQPASSKTTSSRNVTSGAGTSSASSARQPSASASVLSPTEDDVVSPATSPLSML 874
>SAT1_SCHPO (O60183) Protein sat1| Length = 550 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 362 QHILHWLDGGRSEGFGGCFQEHG 294 QHI LDG +E GG FQ+HG Sbjct: 267 QHIKKLLDGESNEEGGGEFQDHG 289
>GLHA_RABIT (P07474) Glycoprotein hormones alpha chain precursor (Anterior| pituitary glycoprotein hormones common alpha subunit) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain) (Luteinizing hormone a Length = 120 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 176 VLVSSRSKDVHMLHSFSGNPFQLERKP*SLRCLNRDAPLVMEPKSLCCGCC 24 V++++ S +H+LHSF F ++ P N+ + P C GCC Sbjct: 10 VILATLSVFLHILHSFPDGEFAMQGCPECKLKENKYFSKLGAPIYQCMGCC 60
>GLHA_EQUBU (O46642) Glycoprotein hormones alpha chain precursor (Anterior| pituitary glycoprotein hormones common alpha subunit) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain) (Luteinizing hormone a Length = 120 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 176 VLVSSRSKDVHMLHSFSGNPFQLERKP*SLRCLNRDAPLVMEPKSLCCGCC 24 V++++ S +H+LHSF F + P +N+ + P C GCC Sbjct: 10 VILATLSVFLHILHSFPDGEFTTQDCPECKLKVNKYFSKLGVPIYQCMGCC 60
>GLHA_CANFA (Q9XSW8) Glycoprotein hormones alpha chain precursor (Anterior| pituitary glycoprotein hormones common alpha subunit) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain) (Luteinizing hormone a Length = 120 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 176 VLVSSRSKDVHMLHSFSGNPFQLERKP*SLRCLNRDAPLVMEPKSLCCGCC 24 V++++ S +H+LHSF F ++ P N+ + P C GCC Sbjct: 10 VILAALSVFLHILHSFPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCC 60
>GLHA_AILME (Q8WN20) Glycoprotein hormones alpha chain precursor (Anterior| pituitary glycoprotein hormones common alpha subunit) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain) (Luteinizing hormone a Length = 120 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 176 VLVSSRSKDVHMLHSFSGNPFQLERKP*SLRCLNRDAPLVMEPKSLCCGCC 24 V++++ S +H+LHSF F ++ P N+ + P C GCC Sbjct: 10 VILTTLSVFLHILHSFPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCC 60
>GLHA_AILFU (Q8HZS0) Glycoprotein hormones alpha chain precursor (Anterior| pituitary glycoprotein hormones common alpha subunit) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain) (Luteinizing hormone a Length = 120 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 176 VLVSSRSKDVHMLHSFSGNPFQLERKP*SLRCLNRDAPLVMEPKSLCCGCC 24 V++++ S +H+LHSF F ++ P N+ + P C GCC Sbjct: 10 VILATLSVFLHILHSFPDGEFTMQGCPECKLKENKYFSKLGAPIFQCMGCC 60
>CYAA_LEIDO (Q27675) Receptor-type adenylate cyclase A (EC 4.6.1.1) (ATP| pyrophosphate-lyase) (Adenylyl cyclase) Length = 1380 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -1 Query: 379 LARLTVSIYCIGWTAAEVKASEDAFKSMAEANP 281 L R +Y + ++ + V+ E+AF +MA+ NP Sbjct: 231 LLRDPAVLYTVPYSESSVEVDEEAFDAMADTNP 263 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,771,749 Number of Sequences: 219361 Number of extensions: 993670 Number of successful extensions: 2215 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2214 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
