Clone Name | rbastl56d04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 pr... | 28 | 6.0 | 2 | NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 pr... | 28 | 6.0 | 3 | CB024_HUMAN (Q9BV87) Protein C2orf24 | 28 | 7.9 |
---|
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -1 Query: 187 CVCV-------CDRELCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 50 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 704 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDK 756
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -1 Query: 187 CVCV-------CDRELCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 50 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 706 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDK 758
>CB024_HUMAN (Q9BV87) Protein C2orf24| Length = 410 Score = 27.7 bits (60), Expect = 7.9 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = -1 Query: 271 SISI*SEHVRRRDLMLLCYPCLLTPELACVCVCDRELC-----RCMNN*GNKGACTTGLI 107 ++++ S V + L L C P P+L C E C +C+ + N +C G + Sbjct: 244 ALAVASVAVIHQSLGLSCTPTPGPPDLGLTSRCLLEPCIPSVPQCLPSPANVSSCLEGSM 303 Query: 106 GMRKL 92 G+R L Sbjct: 304 GLRSL 308 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,330,702 Number of Sequences: 219361 Number of extensions: 690999 Number of successful extensions: 1617 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1615 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)