ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl56d01 |
|---|---|
| Clone Library Name | barley_pub |
>GDE_HUMAN (P35573) Glycogen debranching enzyme (Glycogen debrancher) [Includes:| 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (EC 3.2.1.33) (Amylo-1,6-glucosidase) (Dextrin 6-alpha-D-glucosidase)] Length = 1532 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = -3 Query: 243 TAGGENNTSFTF---KWNCGLWTDREGE 169 TAG + T F + ++NCG W D+ GE Sbjct: 1238 TAGVDEETGFVYGGNRFNCGTWMDKMGE 1265
>NEU2_PIG (P01183) Vasopressin-neurophysin 2-copeptin precursor (AVP-NPII)| [Contains: Lys-vasopressin; Neurophysin 2 (Neurophysin-I/-III); Copeptin] Length = 166 Score = 28.5 bits (62), Expect = 4.5 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -1 Query: 305 RCCKQKLCCG-----YVQYI*ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRV 147 RC +CCG +V A+ ++ QEE +P SG CG GR A + Sbjct: 51 RCFGPSICCGDELGCFVGT--AEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDE 108 Query: 146 SCITD 132 SC+T+ Sbjct: 109 SCVTE 113
>NEU2_LOXAF (P81768) Neurophysin 2 (Neurophysin-II) (E-NP)| Length = 92 Score = 28.5 bits (62), Expect = 4.5 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -1 Query: 305 RCCKQKLCCG-----YVQYI*ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRV 147 RC +CCG +V A+ ++ QEE +P SG CG GR A + Sbjct: 20 RCFGPSICCGEELGCFVGT--AEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCYEE 77 Query: 146 SCITD 132 SC+T+ Sbjct: 78 SCVTE 82
>NEU2_HORSE (P01182) Neurophysin 2 (Fragment)| Length = 92 Score = 28.5 bits (62), Expect = 4.5 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -1 Query: 305 RCCKQKLCCG-----YVQYI*ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRV 147 RC +CCG +V A+ ++ QEE +P SG CG GR A + Sbjct: 17 RCFGPSICCGDELGCFVGT--AEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDE 74 Query: 146 SCITD 132 SC+T+ Sbjct: 75 SCVTE 79
>NEU2_BOVIN (P01180) Vasopressin-neurophysin 2-copeptin precursor (AVP-NPII)| [Contains: Arg-vasopressin; Neurophysin 2 (Neurophysin-II); Copeptin] Length = 166 Score = 28.5 bits (62), Expect = 4.5 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -1 Query: 305 RCCKQKLCCG-----YVQYI*ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRV 147 RC +CCG +V A+ ++ QEE +P SG CG GR A + Sbjct: 51 RCFGPSICCGDELGCFVGT--AEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDE 108 Query: 146 SCITD 132 SC+T+ Sbjct: 109 SCVTE 113
>GDE_CANFA (Q2PQH8) Glycogen debranching enzyme (Glycogen debrancher) [Includes:| 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (EC 3.2.1.33) (Amylo-1,6-glucosidase) (Dextrin 6-alpha-D-glucosidase)] Length = 1533 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -3 Query: 243 TAGGENNTSFTF---KWNCGLWTDREGE 169 TAG + T F + + NCG W D+ GE Sbjct: 1239 TAGVDEETGFVYGGNRLNCGTWMDKMGE 1266
>Y2806_XANCP (Q8P708) UPF0042 protein XCC2806| Length = 282 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 106 NALFQIASLSVMQLTRRIVTHFAL 177 +A+ ++L+V QL RR+VT FAL Sbjct: 132 DAIIDTSALNVHQLRRRVVTEFAL 155
>CHEB_CLOAB (Q97GZ3) Chemotaxis response regulator protein-glutamate| methylesterase (EC 3.1.1.61) Length = 345 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 65 VTFISVWQKGIKHTMHCSRLPAY 133 + F S+ QKG+K+TM C L A+ Sbjct: 81 IVFSSISQKGMKYTMECLYLGAF 103
>NEU2_BALPH (P01184) Vasopressin-neurophysin 2 precursor [Contains:| Arg-vasopressin; Neurophysin 2] (Fragment) Length = 107 Score = 27.3 bits (59), Expect = 9.9 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 5/63 (7%) Frame = -1 Query: 305 RCCKQKLCCGYVQYI*---ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRVSC 141 RC +CCG A+ ++ QEE +P SG CG GR A + SC Sbjct: 32 RCFGPSICCGDELGCFMGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESC 91 Query: 140 ITD 132 +T+ Sbjct: 92 VTE 94
>CHFR_MOUSE (Q810L3) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (Checkpoint| with forkhead and RING finger domains protein) Length = 664 Score = 27.3 bits (59), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 117 EQCIVCLIPFCH 82 +QC VCL PFCH Sbjct: 508 QQCAVCLQPFCH 519
>CHFR_HUMAN (Q96EP1) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (Checkpoint| with forkhead and RING finger domains protein) Length = 664 Score = 27.3 bits (59), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 117 EQCIVCLIPFCH 82 +QC VCL PFCH Sbjct: 508 QQCAVCLQPFCH 519
>CCPR2_DEBHA (Q6BIB1) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 428 Score = 27.3 bits (59), Expect = 9.9 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 16/64 (25%) Frame = -2 Query: 151 ELVASQISWQSGTVHCVFDSFLP--------Y*NKGHFSLCF---GWKDTK-----GALG 20 E+ +I W+ G V C+ D ++P Y N H F G+ D + GA G Sbjct: 254 EMGGPKIPWRCGRVDCIDDRYVPPNGRLPFAYKNANHIRETFGRMGFNDRETVLLLGAHG 313 Query: 19 IRRC 8 + RC Sbjct: 314 LGRC 317
>NEU2_SHEEP (P01181) Vasopressin-neurophysin 2-copeptin precursor (AVP-NPII)| [Contains: Arg-vasopressin; Neurophysin 2 (Neurophysin-III); Copeptin] (Fragment) Length = 147 Score = 27.3 bits (59), Expect = 9.9 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -1 Query: 305 RCCKQKLCCG-----YVQYI*ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRV 147 RC +CCG +V A+ ++ QEE +P SG CG GR A + Sbjct: 32 RCFGPSICCGDELGCFVGT--AEALRCQEEIYLPSPCQSGQKPCGSGGRCAAAGICCNDE 89 Query: 146 SCITD 132 SC+T+ Sbjct: 90 SCVTE 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,263,591 Number of Sequences: 219361 Number of extensions: 887786 Number of successful extensions: 2069 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2069 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
