Clone Name | rbastl56c11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ASCC2_HUMAN (Q9H1I8) Activating signal cointegrator 1 complex su... | 33 | 0.16 | 2 | ASCC2_MOUSE (Q91WR3) Activating signal cointegrator 1 complex su... | 30 | 1.7 |
---|
>ASCC2_HUMAN (Q9H1I8) Activating signal cointegrator 1 complex subunit 2 (ASC-1| complex subunit p100) (Trip4 complex subunit p100) Length = 757 Score = 33.5 bits (75), Expect = 0.16 Identities = 18/62 (29%), Positives = 28/62 (45%) Frame = +1 Query: 1 DTQRQSIHTYSGQQQQQSTVGASVPQGDGMGDDDDKTERVLES*HKTKATERRHTMVFRR 180 + +R + G + ST A P+G G + + R E+ T+A R TM R+ Sbjct: 690 EARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRK 749 Query: 181 RS 186 RS Sbjct: 750 RS 751
>ASCC2_MOUSE (Q91WR3) Activating signal cointegrator 1 complex subunit 2 (ASC-1| complex subunit p100) (Trip4 complex subunit p100) Length = 749 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = +1 Query: 1 DTQRQSIHTYSGQQQQQSTVGASVPQGDGMGDDDDKTERVLES*HKTKATERRHTMVFRR 180 + +R + G + + ST P+G G + + R E+ +A R TM R+ Sbjct: 682 EARRMAFLARKGYRPENSTAVTGGPRGHGQSRETTQERRKKEANKAARANHNRRTMADRK 741 Query: 181 RS 186 RS Sbjct: 742 RS 743 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,848,903 Number of Sequences: 219361 Number of extensions: 387503 Number of successful extensions: 1325 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1325 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)