Clone Name | rbastl56b10 |
---|---|
Clone Library Name | barley_pub |
>SUVH7_ARATH (Q9C5P1) Histone-lysine N-methyltransferase, H3 lysine-9 specific| SUVH7 (EC 2.1.1.43) (Histone H3-K9 methyltransferase 7) (H3-K9-HMTase 7) (Suppressor of variegation 3-9 homolog protein 7) (Su(var)3-9 homolog protein 7) (Protein SET DOMAIN GR Length = 693 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = +1 Query: 16 GCSNC----ILHRNCNCVTRNYD 72 GC NC +H+NC CV RN D Sbjct: 457 GCQNCRHQPCMHQNCTCVQRNGD 479
>PURA_DROME (Q9Y0Y2) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 447 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 254 DRVEPCIVIHKHVQGIQEAEKGKQEIKKRCEGL 156 DR H+HV G+QEAEKG + + +G+ Sbjct: 125 DRAHLVFDFHQHVDGMQEAEKGGKSLGTTKKGI 157
>EF2_SULAC (P23112) Elongation factor 2 (EF-2)| Length = 736 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 257 EDRVEPCIVIHKHVQGIQEAEKGKQEIKKRCEGLVV 150 E+RV P + I+K + I+E + QEI+KR L++ Sbjct: 136 EERVRPILFINKVDRLIKELKLSSQEIQKRLIDLII 171
>SACB_STRMU (P11701) Levansucrase precursor (EC 2.4.1.10)| (Beta-D-fructofuranosyl transferase) (Sucrose 6-fructosyl transferase) Length = 795 Score = 28.1 bits (61), Expect = 6.2 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 5 KIIKDVAIVSCTETATVSQETTINRYSGATTELGDTFYRSCGKNPQNARQLSPRN 169 K+I D A V + T Q T+ + S +T E+G T ++ K + A +P+N Sbjct: 94 KVITDNAAVESKASKTKDQAATVTKTSASTPEVGQTNEKA--KATKEADITTPKN 146
>UBP22_MOUSE (Q5DU02) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -3 Query: 163 RA*LSCVLWIFTTRAVEGVPQFCCSTTVSIYRSFL*HSCSFCARYNCY 20 RA C +W T A + + C I+ + L HSC +C + C+ Sbjct: 39 RAIYQCFVWSGTAEARKRKAKSCVCHVCGIHLNRL-HSCLYCVFFGCF 85
>UBP22_HUMAN (Q9UPT9) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 163 RA*LSCVLWIFTTRAVEGVPQFCCSTTVSIYRSFL*HSCSFCARYNCY 20 RA C +W T A + + C ++ + L HSC +C + C+ Sbjct: 39 RAIYQCFVWSGTAEARKRKAKSCICHVCGVHLNRL-HSCLYCVFFGCF 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,913,103 Number of Sequences: 219361 Number of extensions: 590483 Number of successful extensions: 1705 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1704 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)