Clone Name | rbastl56b07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KRA13_HUMAN (Q8IUG1) Keratin-associated protein 1-3 (Keratin-ass... | 28 | 6.6 | 2 | PILS_PSEAE (P33639) Sensor protein pilS (EC 2.7.13.3) | 28 | 8.7 | 3 | CHI2_PEA (P21226) Endochitinase A2 precursor (EC 3.2.1.14) | 28 | 8.7 | 4 | LYSC1_CANFA (P81708) Lysozyme C, milk isozyme (EC 3.2.1.17) (1,4... | 28 | 8.7 |
---|
>KRA13_HUMAN (Q8IUG1) Keratin-associated protein 1-3 (Keratin-associated protein| 1.8) (Keratin-associated protein 1.9) Length = 177 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 156 SNSASSSCHDPICAGWICCASSRFSVNRCG 67 S + SSSC P C CC S + CG Sbjct: 63 SGTCSSSCCQPSCCETSCCQPSCCQTSSCG 92
>PILS_PSEAE (P33639) Sensor protein pilS (EC 2.7.13.3)| Length = 530 Score = 27.7 bits (60), Expect = 8.7 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -1 Query: 194 LSLCNLCWLFGEIVTALPVLATILFVLVGSVVRARVSLSIAADADYLNLLTTLF 33 L LC L + G + + + L + + ++R R+ L IAA A L T F Sbjct: 88 LMLCGLFYAGGGVPSGIGSLLVVAVAIANILLRGRIGLVIAAAASLGLLYLTFF 141
>CHI2_PEA (P21226) Endochitinase A2 precursor (EC 3.2.1.14)| Length = 324 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -3 Query: 192 VSL*PVLVVWRNSNSASSSCHDPICAGWICCASSR 88 +S L W S SCHD I GW ++ R Sbjct: 214 ISFKTALWFWMTPQSPKPSCHDVITGGWTPSSADR 248
>LYSC1_CANFA (P81708) Lysozyme C, milk isozyme (EC 3.2.1.17)| (1,4-beta-N-acetylmuramidase C) Length = 129 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 162 RNSNSASSSCHDPICAGWICCASSRFSVNRCGRRLSELADDPV 34 RNSN +S + + W C ++S S N C S+ DD + Sbjct: 46 RNSNGSSDYGIFQLNSKWWCKSNSHSSANACNIMCSKFLDDNI 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,955,682 Number of Sequences: 219361 Number of extensions: 404043 Number of successful extensions: 1674 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1670 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)